(data stored in ACNUC7421 zone)

EMBL: CP002160.PE201

CP002160.PE201       Location/Qualifiers
FT   CDS_pept        290759..291622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0208"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: cbl:CLK_1587
FT                   carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49992"
FT                   /db_xref="GOA:D9SNX1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNX1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADL49992.1"
FT                   /translation="MSIYKSQDGKIASIKLYDAQLQKLGYLFSDKYVTTSFGKIHLIET
FT                   GNMKGKPLLVFHGGNSTTAYNLLMYKFLLKDFHVYAIDTIGHPGKSDEVCLSSNNYDYG
FT                   KWASEVITAIGYDKISCFGVSFGGGILAKLMCIAPEKIEKAVLVVPAGINNALPISSVK
FT                   MLIPLIKYVVTKKEKYLKETALYMALSEIVLDEDTLDTIKDSFDNVKTKVGMPSNIMRK
FT                   LLRNYKTPTLVMAAEKDCLFPAKRVLSRAKTIIPNCKVHMLKGCGHMHIMPQYEKKMIV
FT                   DFLIDS"
     atgagcatat ataaatcaca agatggaaaa attgcgtcaa taaaattata tgatgcacaa        60
     ttgcaaaagt taggatatct atttagtgat aaatatgtaa ctacaagttt tgggaagatt       120
     catcttattg aaactggaaa tatgaaaggg aagccccttt tagtttttca tggtggaaat       180
     agtacaacag catacaattt attgatgtat aaatttttgt taaaggattt tcatgtttat       240
     gctatagaca caataggaca tcctgggaaa agtgatgaag tttgtttatc ctcgaataat       300
     tatgattacg gaaagtgggc aagtgaagta attactgcaa taggatatga taaaataagt       360
     tgttttggag tttctttcgg tggaggaatt ttggcaaaac ttatgtgcat tgcaccagaa       420
     aagattgaaa aagcagtttt agttgtgcca gcaggtatta ataatgcatt gccaatatct       480
     tcagtaaaga tgctaattcc attgataaag tatgttgtga caaagaaaga aaagtatcta       540
     aaagaaacag ctttatatat ggcactttct gaaatagttc tggatgaaga tacattagat       600
     actataaaag atagttttga taatgtaaaa accaaagtag gaatgccaag caatattatg       660
     aggaaattat taagaaatta taaaactcca acactggtta tggcggcaga gaaggattgt       720
     cttttccctg ctaaaagggt tttatctcga gcaaaaacaa ttattccaaa ctgcaaggtc       780
     catatgttaa aaggatgtgg tcatatgcat ataatgcctc aatatgaaaa gaaaatgatt       840
     gttgattttc ttattgatag ttag                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page