(data stored in ACNUC7421 zone)

EMBL: CP002160.PE205

CP002160.PE205       Location/Qualifiers
FT   CDS_pept        296829..299501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0212"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG: diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); SMART:
FT                   EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49996"
FT                   /db_xref="GOA:D9SPE7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPE7"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADL49996.1"
FT                   /translation="MYKEIKNSVPITTVVSSILLLVFALLAVITKVYSFPFILGVTFSL
FT                   SGVFLLIILKLYNINTALVVAIIAQLAEIISSDYPYWGFIFVLEIAFVGLYSIWKPKNN
FT                   LIFGDLLFWIFIGIPVSAVAYYTLFYNGGWDAYIMRISADIICGLSSCAFVDGLLTYVP
FT                   TEKLLKKLGKTDDSIQFLKFLFVFISVILSVSILSTFIISGFNTYSAVNEKNEQIVQDY
FT                   LDDIRREVSVMDKNQQAQLLFYGVLQAGQLEELIEKLQSEKKADIIITDTSNKVVATNI
FT                   DKVKHGQVFDWQKDTLTVKELEGVYAVTPYKKYGRIETEAWAEGNYFYTREIGLLDLKL
FT                   IVSFPIKQIQQEVLNNYASKFRFVMYFIIFSLLVAVVTNRLLVKSIKKLSAATTAVPVR
FT                   IKNAEQIEWPNSGIYEVKQLITNFKDMSDNFKKMFMESQELNKTLALQADELLKSEVKL
FT                   HKLAYYDTLTNLPNRHMFKMYLEEKLQMARKNNNIIGVIFIDLNQFKKINDTMGHSAGD
FT                   DLLAIFSKRFISIKSDNTEVFRLGGDEFVFVVIAEEENQVKLFGEEIAKIFIKPVELLG
FT                   AILSVTGSIGISMYPKDGQDLDTLVKYADLAMYRSKEMGGCNIEYFNKEIHRDFEENMI
FT                   LETGIRKALEDNEFELYYQPKINAQTGAITSCEALIRWKHLDLGYVSPMKFITVAEKSG
FT                   LIFQIDKWVINEACRQNVQWQLEGRKKIPVSVNVSAKHFFEGQLVDVVKEALKNNGIEP
FT                   KYLRVEITEGVLIKDKQFVADIIKRLAGLGVLVSLDDFGTGYSSFSHLFQLPISELKLD
FT                   REFIQGIDKYEKKGAMVKIMIEFAHNLELNVVAEGIETLEEYKFLQEIKCDELQGYLFS
FT                   KPVKNEEFKDLISAVNINV"
     atgtacaaag aaattaaaaa ttcagttcca atcacgactg ttgtaagcag cattttatta        60
     ttagtgtttg ctcttctcgc agtcataact aaagtatata gttttccttt catactagga       120
     gttacctttt ccttatctgg agtttttctg ttaattatac ttaaacttta taatattaat       180
     actgccttag tggtggcaat aattgctcag ttggcagaga taatttcttc tgattaccct       240
     tattggggtt ttatatttgt tctggaaatc gcttttgtcg gtttgtactc aatttggaag       300
     ccaaagaata atttgatttt tggtgatctg ttattttgga ttttcattgg tattccggta       360
     tcggcagtgg catattatac cttattttat aatggaggtt gggatgccta tataatgcga       420
     atttctgctg acataatttg cggtctttca tcctgtgctt ttgtggatgg tttattaact       480
     tatgtaccta ctgaaaagct attaaaaaag ctggggaaaa cagatgattc aattcaattt       540
     cttaaattct tatttgtttt tatatcagtg atattgagtg taagtatcct gtcaaccttt       600
     attatcagtg gcttcaatac ctatagtgcc gtcaatgaaa aaaatgagca gatagttcag       660
     gattatttag atgatattcg acgggaagtt agcgtaatgg ataaaaatca gcaagctcaa       720
     ttattgtttt atggagtctt gcaggcagga caattggagg aactaataga aaagcttcaa       780
     tctgagaaaa aagcggacat aattattaca gatacaagca ataaggtagt agctaccaat       840
     attgataaag tgaagcatgg acaggtattt gattggcaaa aagatacatt aacagtgaaa       900
     gagttagaag gagtatatgc agttactcct tataaaaaat acggaagaat tgaaacagag       960
     gcatgggctg aaggcaatta cttttataca agagagatag gtttacttga tttaaagtta      1020
     attgtcagct ttcctattaa gcaaatacag caggaagttt tgaataatta tgctagcaaa      1080
     ttcagattcg taatgtattt tataattttc tctctgttag ttgcagtagt aaccaacaga      1140
     ctattagtta aatcaattaa aaaattgtct gctgcaacca cagcagttcc agtgagaatt      1200
     aagaatgctg aacaaattga atggcctaat agcggaattt atgaggtcaa acagttaata      1260
     acaaacttca aagatatgtc agataatttt aaaaagatgt ttatggaaag ccaagagttg      1320
     aataaaacac ttgcgctgca agctgatgaa ttgctgaaat cagaagtaaa acttcacaag      1380
     ctagcttatt atgatactct tacaaatctt cctaacagac atatgtttaa aatgtatcta      1440
     gaagaaaaat tacagatggc gagaaaaaat aataatataa ttggtgtaat cttcatcgat      1500
     cttaaccagt ttaaaaaaat aaatgataca atggggcatt cggcagggga cgacttgcta      1560
     gctattttct ccaaaaggtt tattagtata aaaagtgata ataccgaagt atttagactt      1620
     ggcggagatg agtttgtttt tgtagtgatt gctgaagaag agaaccaggt aaaacttttt      1680
     ggtgaagaga ttgccaagat atttatcaag cctgtggaac ttttgggtgc aattctcagt      1740
     gttactggca gtatcggaat aagcatgtat ccaaaagatg ggcaagattt ggatactctt      1800
     gttaaatatg cagatttagc aatgtacagg tcgaaagaaa tgggaggctg taacattgag      1860
     tatttcaata aggaaataca tagagacttt gaagaaaata tgattttgga aacaggaatt      1920
     aggaaagcat tagaggacaa tgaattcgag ttgtattacc aacccaaaat caatgctcaa      1980
     actggagcga ttacaagctg tgaagctctc attcgatgga agcacctaga ccttggatat      2040
     gtttcaccta tgaagtttat aactgtagca gaaaaatcgg ggcttatttt tcaaatagat      2100
     aagtgggtta ttaatgaggc ctgcaggcaa aatgttcagt ggcagcttga aggtaggaag      2160
     aagatacctg tatctgtaaa tgtgtcagcg aagcatttct ttgaggggca actggtagat      2220
     gtggttaagg aggctttaaa aaataatgga atagagccga agtatctaag agtggaaata      2280
     accgaaggag ttcttataaa ggacaaacaa tttgttgctg atatcataaa acggcttgca      2340
     ggattaggag ttttagtttc cttagatgat tttggtacag gatattcgtc attcagccat      2400
     ctgtttcagc ttcctataag tgaacttaaa ctggataggg aatttataca gggaatagac      2460
     aagtatgaga aaaaaggggc tatggtaaaa ataatgatag aatttgctca taatctagaa      2520
     ttgaatgttg ttgctgaagg aatagaaaca ttagaggaat ataagttttt acaagagatt      2580
     aaatgcgatg aactccaagg ttaccttttt agcaagccag tgaaaaatga agagtttaag      2640
     gatcttatat ctgcagttaa tataaacgta taa                                   2673
//

If you have problems or comments...

PBIL Back to PBIL home page