(data stored in ACNUC7421 zone)

EMBL: CP002160.PE206

CP002160.PE206       Location/Qualifiers
FT   CDS_pept        299569..300906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0213"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: cth:Cthe_1957 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49997"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPE8"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL49997.1"
FT                   /translation="MGKRSVVLIAILIFISLTVDFGKYRLSTNNQFTQTDVKDESKDDE
FT                   KSDSSNEPINLTILSYYKDFENQANEYHKAHPNVNIKIDVVDYDHIIETAFKSIASGSS
FT                   PDIIVFDSNHTFNLNGNEALQNLLEEPFSAGKYKQGFAEDLWRSVLSYDKNRLIGIPLV
FT                   INDMVTLYRADIMEQYGFPSEPEALAQYMKNPENWLKIAETLKLDNKYIASWATDPLNI
FT                   YGSGTGIFDENLNLLRLDSNFEKAIELSQNIKMNGLSLNGDIYSEDGKQALKDGRLAMV
FT                   YGGSWLIYNFKDLVPEERGKWRVAKLPFGINGFGSSNIMAISSTSKYKEEAWDFIKTFE
FT                   LDDKKSYWGGSIPVYLPAVNNIKNFSNKDAFFGDQDLGLFFKDIRQSTKVPVFTPLDDM
FT                   AMSIWKDKTQYAIANAVNPKDALKQYEEEINSRLADKKKILLDRKQ"
     atgggtaaga gatcagttgt tttgatagca attttaattt ttataagctt aacagtagat        60
     tttggtaagt ataggttaag cactaataat cagtttaccc aaactgatgt taaggatgaa       120
     agtaaagacg atgaaaaaag tgatagttca aatgagccta taaatctgac tatattatct       180
     tattataaag attttgaaaa tcaagctaac gaatatcata aggctcatcc aaatgtaaat       240
     ataaagattg atgtagtaga ttatgatcac attattgaga ctgccttcaa gtccatagca       300
     agtggttcaa gtccagacat tatcgtcttt gactccaacc acacctttaa tttaaacggg       360
     aatgaggcat tgcagaattt actggaagaa ccattttcag caggaaagta taagcagggg       420
     ttcgcagagg atctttggcg ttctgtattg tcttacgaca agaataggct tataggtatt       480
     cccttagtta taaatgatat ggttacacta tatcgagctg atataatgga gcaatacggc       540
     tttccttcgg aaccagaagc tcttgctcag tatatgaaaa atcctgagaa ttggctaaag       600
     attgctgaga ctttaaagct tgataataag tatattgcgt catgggcaac ggatccttta       660
     aatatatatg gatcaggaac aggtattttc gatgaaaacc ttaatttgct tagattggat       720
     agtaactttg agaaagcgat agaactctct caaaacatca aaatgaatgg attgtctttg       780
     aatggtgata tatatagtga ggacggaaaa caagctctga aagacggtag gcttgctatg       840
     gtatatggtg ggtcttggtt aatatacaac tttaaagacc ttgtgcccga agaacgaggc       900
     aaatggcggg ttgcgaaatt accatttggt ataaatggtt ttggtagttc aaatataatg       960
     gctataagtt caacaagtaa atacaaggaa gaagcttggg attttatcaa gacctttgaa      1020
     ctagatgaca aaaagtcata ctggggaggc agtattcctg tgtatttgcc ggcagttaat      1080
     aatataaaga atttcagcaa caaagatgcc ttctttggtg atcaggacct tggattattt      1140
     tttaaagata tccgtcaatc aacaaaagtt cccgtattta cgccattaga cgatatggca      1200
     atgtcaattt ggaaggataa aacccaatat gcaatagcta atgctgttaa tccaaaggac      1260
     gctttgaagc aatatgaaga agaaattaat agcaggttgg cagacaaaaa gaaaatttta      1320
     ttagatagaa aacagtaa                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page