(data stored in ACNUC7421 zone)

EMBL: CP002160.PE209

CP002160.PE209       Location/Qualifiers
FT   CDS_pept        302785..303222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50000"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF1"
FT                   /inference="similar to AA sequence:KEGG:CLK_1328"
FT                   /protein_id="ADL50000.1"
FT                   /translation="MIIKAIKDYISTCSYLQEFEAAICAVVGSGTSNSELYAIEVVKAE
FT                   PILKKYMNGDSLRQCHFTFCSKESYGIDVLRSIESSSFYDDFENWIEEENRKGNLPSLT
FT                   GNYIPVEIKVISSGYAFPVSQDKSRYQIELILNYYKKQGGN"
     atgattatta aggcaataaa ggattatata agtacttgct cttatctgca agaatttgaa        60
     gctgctatat gtgctgtagt tgggtctgga actagtaatt cagaactgta tgctattgaa       120
     gtagttaaag cagagccaat tttaaagaaa tatatgaatg gcgattccct aaggcaatgc       180
     cactttactt tttgcagtaa agaaagctat gggatcgatg tattacgaag catagaaagt       240
     agcagctttt atgatgattt tgaaaattgg attgaggaag aaaacagaaa aggaaattta       300
     ccaagcctaa cgggaaatta catacccgtt gaaataaagg ttatatctag cggatatgct       360
     ttcccagtgt cacaggacaa gtcgagatac caaatagaac taatattaaa ttattacaag       420
     aaacaaggag gaaattaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page