(data stored in ACNUC7421 zone)

EMBL: CP002160.PE214

CP002160.PE214       Location/Qualifiers
FT   CDS_pept        305175..306821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0221"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1322 phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50005"
FT                   /db_xref="GOA:D9SPF6"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF6"
FT                   /inference="similar to AA sequence:KEGG:CLK_1322"
FT                   /protein_id="ADL50005.1"
FT                   /translation="MADEKKCNCGNDASEEQTDLQKYTEEVKALAKGGFDVLSNSAINV
FT                   VSKLKEIGLEGIKLAGNLEKVQGSFPNNIDSFSSQMDIANSNIEGLITDLGQILLPIAT
FT                   EVVKKFNEVADKVKNALANPEVQASIQGLAKDIGDLVNGALSFFADNLDIITEGLTWVM
FT                   DNSEVILAGIVAIGAALATIAIIGAISSIVGLFVALYEEIATGTPIMEAFNIVVGMNPF
FT                   VLIAAAVIGLIAAFIFLWNTSDGFRNFWIGLWDNIKTIFSDVWNGIMTFFTEVIPGWID
FT                   SLIQWLSGIPQWFSELPGKIGYFLGYLLAQLLLFGINAWTWVTTEVPNIINTIINWFAQ
FT                   LPSNIYNWLMNVVSNLEQWASNMISKAEQAAKDIVGGIINFFKNLPGEMENIGKNIVTG
FT                   IYNGIINAKDWILGKIDEFVSGVVQGFKDALGIHSPSRVLRDEVGKFIAKGIAVGFVAE
FT                   VPKMQGDIDSSMSDMVARMQGAVGCEIAATTANVASNNSAITKDNAINDTLMNSNGKVI
FT                   ENHIHVDIEGREVAKAVAPYQGVFDTYQIGR"
     atggcagatg agaaaaaatg caattgtgga aatgatgcaa gcgaagagca aactgaccta        60
     cagaaatata ctgaggaagt taaagcctta gctaaaggtg gttttgatgt actttctaat       120
     agtgccatca atgtggtatc taagttaaaa gaaattgggc ttgaaggaat taagttagct       180
     ggtaaccttg aaaaagtcca aggaagtttc ccaaataata ttgatagttt ctctagtcaa       240
     atggatatag ctaattcaaa cattgaaggg ttaatcacag atttaggtca aattctatta       300
     cctatagcaa cagaggtggt taagaaattt aatgaagttg ctgataaagt aaagaatgct       360
     ttagctaatc cagaagtcca agctagcatt cagggattag ctaaagatat aggagattta       420
     gtaaatggag ctttgagctt tttcgcagat aatcttgata tcataactga gggtcttact       480
     tgggtgatgg acaattcaga ggttatactt gctgggattg tagctattgg agctgcatta       540
     gctacaatag caattattgg ggcaataagt tctattgtag gtttgtttgt agcattatat       600
     gaagaaatag ccacaggaac tccaataatg gaggccttta atatagttgt aggaatgaat       660
     ccttttgttc ttattgctgc tgcagtaata ggattaattg ctgcttttat ttttctatgg       720
     aacacaagtg atggatttag aaacttttgg attggacttt gggataatat aaaaactatc       780
     ttttctgatg tttggaatgg cataatgacc ttctttacag aagtaatacc aggatggata       840
     gacagcctta ttcaatggtt aagtggtatt ccacaatggt tttctgagct tcctggaaag       900
     attggttact ttttaggata tcttttggca cagttacttt tgtttggaat taatgcttgg       960
     acgtgggtaa ccacagaggt tcctaatata ataaatacta taatcaattg gtttgcgcaa      1020
     ttaccaagca atatttataa ctggttgatg aatgtagttt caaatttaga acaatgggct      1080
     tcaaatatga tttcaaaagc tgagcaagcg gcaaaagata tagttggggg aataattaac      1140
     ttttttaaga atttacctgg cgaaatggag aacataggta aaaatatagt tactggaatt      1200
     tataatggga taatcaatgc aaaagattgg attcttggca aaattgacga atttgttagt      1260
     ggagtagttc aaggatttaa ggatgcctta ggaatacatt cgccttctag ggtactgcga      1320
     gatgaagttg gtaagtttat agctaaaggt attgcagttg gatttgtagc tgaagtacct      1380
     aagatgcaag gagacattga ttccagtatg tccgatatgg tcgctagaat gcagggtgca      1440
     gtaggctgtg aaattgcagc aacaacagct aatgtagctt ctaacaatag tgcaatcaca      1500
     aaagacaacg caataaatga tactcttatg aatagcaatg gcaaggtaat agaaaaccat      1560
     atccatgtgg atatcgaagg aagagaagtc gccaaggctg tagctccata ccaaggagta      1620
     tttgatacat atcagatagg aaggtga                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page