(data stored in ACNUC7421 zone)

EMBL: CP002160.PE217

CP002160.PE217       Location/Qualifiers
FT   CDS_pept        310053..310259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0224"
FT                   /product="peptide chain release factor 2"
FT                   /note="KEGG: art:Arth_2666 peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50008"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF9"
FT                   /inference="similar to AA sequence:KEGG:Arth_2666"
FT                   /protein_id="ADL50008.1"
FT                   /translation="MSKKIITSYTNIKTAEGERLSYTVSTIDDNGNLITSNERKNCIVF
FT                   DEEALAHIEAIRKLLQDRELAVL"
     atgagtaaaa aaataataac aagctatacg aacataaaaa ctgctgaagg tgaaaggctt        60
     tcctatacag ttagtactat agacgataat ggaaatctta taacaagcaa cgaaagaaaa       120
     aattgtattg tctttgatga agaagccctt gcacatatag aagctataag aaaacttctt       180
     caggataggg aattagctgt tttataa                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page