(data stored in ACNUC7421 zone)

EMBL: CP002160.PE219

CP002160.PE219       Location/Qualifiers
FT   CDS_pept        312859..314934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00703530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50010"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG1"
FT                   /inference="similar to AA sequence:KEGG:TTHERM_00703530"
FT                   /protein_id="ADL50010.1"
FT                   /translation="MQNTISMSIDLKRENHQNKIVQQNDDVLLDIDVYEEGKIKNLEGA
FT                   IIDLSYVNANNTISIIAGNSMVVSGNNVKITCPRDCTRSAGVAKMKLTIVSDSKQVSTF
FT                   PISITIVPDVLEGQEVSKNIATIIEGLTAANTTATITYNELMQAIELGNIPQLTNRVVN
FT                   LEKEVNRIEPSQFIEAGDTCDVESINRMIQYASANNLVAFIPKRFSDYIINSPIYVPSN
FT                   ITLLSNGATIKLADKSNCRYCIVNEDRINGNSNIKIIGLRINANQTNQNDSLIIGNIIG
FT                   ICFESLSNTSACHDCMAILNYIYDSSIAIRSWVSDENLTGSRMHCYNMTFSHNTLEKCI
FT                   NKIIELGVTDRSLVSSNVCKQCTDGIQVIFNSNYNMVSNNIIECTATGLNITHNSCYNT
FT                   FTNNYVSGYGYLLIMRADAQNTTSIIKGNKITNNTFQMSQGTGTIFSFSKLGSATGSME
FT                   YYDNDISNNSFLGYSSSATAFLRLYNFSSNDVSCKIDKLFLNNNTFANCAIVAGSVDRV
FT                   NCTVGDIILNNNTYTESYVIPGKVAYLYIQGGFFKFDTLNTAIQYNSSSNPTNIFISDL
FT                   VVKAAKLFIALTNSAHTNTISIKRCNVESASTSESVAVHNCNFFFLDNCDIITPDANLG
FT                   VYFSNITGFSGKNNRIFGNSRGFSQKVGSALGGKMTSNEFYGTTTSYENMNNFTIV"
     atgcaaaata cgatatcaat gagtatagat ttaaaaagag aaaatcatca aaataagata        60
     gtacaacaaa atgatgatgt actactggat atagatgttt atgaagaggg taaaattaaa       120
     aacttagaag gagctattat agaccttagc tatgttaatg caaataatac aatatcaatc       180
     atagcaggaa acagtatggt tgtaagtggt aacaatgtta agataacatg tcctagggat       240
     tgcacaaggt ctgctggtgt ggctaagatg aagctaacga tagtctctga ttcaaagcaa       300
     gtaagcacct ttccaatttc cattacaata gttccagatg tattagaagg tcaagaagtt       360
     agtaaaaaca tagctacgat aatagaggga ttaactgcgg caaatactac agctacaatt       420
     acgtataatg aattaatgca agctatagaa ctaggaaata taccacagct aacaaataga       480
     gttgttaatt tggaaaagga ggtaaacaga attgaacctt cacaatttat cgaggctgga       540
     gatacctgtg atgtagagtc aataaataga atgatacaat atgctagtgc aaacaactta       600
     gttgctttta ttcctaaacg gttttcagat tacattataa attcacctat ttatgttcca       660
     agcaatataa ctttattaag taatggtgca actataaaac tagctgataa aagtaattgt       720
     aggtactgta tcgtaaatga agatagaatt aatggaaata gcaatataaa aataatagga       780
     cttagaatta atgctaatca aactaatcaa aatgatagcc ttattatagg aaatattatt       840
     ggtatatgct tcgaaagtct ttcgaataca agtgcgtgtc atgattgtat ggctattctc       900
     aattacatat acgatagttc tatagctatc aggagttggg ttagcgatga aaatttgaca       960
     ggtagcagaa tgcattgtta taacatgaca ttttcacata ataccctaga gaaatgtatt      1020
     aataaaataa tagaattagg tgttacagac agaagtttag tatctagcaa tgtatgcaaa      1080
     caatgtacag atggaattca agttattttt aattctaatt ataatatggt aagtaacaat      1140
     atcattgaat gtactgcaac agggttaaat ataacccata acagttgcta caatactttt      1200
     accaataatt atgtaagtgg ttatggatat ctattgatta tgagagctga tgctcaaaac      1260
     actacaagta tcattaaagg caataagata acaaataata cttttcaaat gtctcaagga      1320
     acagggacaa tattttcatt ttcaaaatta ggttcagcta ctggaagtat ggaatattat      1380
     gataatgata tttcaaacaa ttcattttta ggatatagtt cttcagctac agccttcttg      1440
     agactatata atttttcttc aaatgatgta agttgtaaaa tagataagtt gtttttaaat      1500
     aataatacat ttgccaattg cgctattgtt gctggaagtg tagacagagt gaactgtact      1560
     gttggagata taatactaaa taataataca tatactgaaa gctatgtaat acctgggaaa      1620
     gtagcatatt tatatataca aggcgggttt tttaagtttg atacattaaa cacagctatt      1680
     caatataact caagttctaa tcctacaaat atctttataa gtgatttagt tgtaaaagca      1740
     gctaaacttt ttatagcgtt aacaaattca gctcacacca atacaatttc tattaaaaga      1800
     tgcaacgtgg aaagtgcgtc aacttcagaa tctgtagctg ttcataattg taactttttc      1860
     tttctggata actgcgatat aataacccct gatgcaaatt taggagtata tttcagtaat      1920
     ataacaggat ttagtgggaa aaacaatagg atttttggta attcaagggg cttttcgcaa      1980
     aaagtaggct cagcattagg tggaaaaatg accagtaacg agttttatgg tactaccacc      2040
     agttatgaaa atatgaataa ttttaccatt gtgtag                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page