(data stored in ACNUC7421 zone)

EMBL: CP002160.PE22

CP002160.PE22        Location/Qualifiers
FT   CDS_pept        46913..47644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0024"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624; KEGG:
FT                   bcl:ABC0559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49813"
FT                   /db_xref="GOA:D9SMM8"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM8"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADL49813.1"
FT                   /translation="MRSKASREEQKQFGDNIFTTIMNYVYWFLAGSGLFIISNILFIAC
FT                   MFFVLTTAALGYQIDIISALILLLSAISLGPSITALMGTMGKLVREQDVKIFSEYIRSY
FT                   KLNFKQSISLWAIQLLVIGILVIDYKIFISTSYGRFLIPAVFIIIFLLVNMYIYMFSLM
FT                   SRFFYKSRDLIKISFFYTISKVKNTAINSVIVIVATILIFQYSNIVLFFIPAVMIYGIM
FT                   FNQKSLFESIENKIDEKKSTF"
     atgaggagca aagcatctag ggaagagcaa aagcagtttg gtgataacat ttttactaca        60
     ataatgaact atgtatattg gtttttagca ggtagtggac tgtttataat tagtaacata       120
     ctttttatag cgtgtatgtt tttcgtttta accaccgcag cattaggata tcaaatagat       180
     ataatttctg cacttatatt acttttatca gccatatcgt tagggccatc aattactgca       240
     cttatgggta ccatgggtaa gcttgttcga gaacaagatg ttaaaatttt ttctgaatat       300
     ataagaagct ataagcttaa ttttaaacaa tcaatctcct tatgggctat acaattatta       360
     gtcataggga tactagtcat tgattataag atatttatct ctacatctta tggtagattt       420
     ctaataccag ctgtatttat catcatcttt ttactggtta atatgtatat atatatgttt       480
     tcgcttatgt ctagattctt ctacaaaagt agagacttga taaaaatatc gtttttctat       540
     actatttcca aggtgaaaaa tacagcgata aatagtgtta tagtaatagt tgcaactata       600
     ttaatttttc aatatagtaa cattgtttta tttttcatac cagctgtaat gatttatggt       660
     attatgttta atcagaaatc attatttgaa tctattgaaa ataaaataga cgaaaaaaaa       720
     tctacatttt ag                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page