(data stored in ACNUC7421 zone)

EMBL: CP002160.PE221

CP002160.PE221       Location/Qualifiers
FT   CDS_pept        315737..317017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0228"
FT                   /product="glycoside hydrolase family 25"
FT                   /note="KEGG: cpf:CPF_1568 glycosy hydrolase family protein;
FT                   PFAM: glycoside hydrolase family 25; Peptidoglycan-binding
FT                   lysin domain; SMART: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50012"
FT                   /db_xref="GOA:D9SPG3"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG3"
FT                   /inference="protein motif:PFAM:PF01183"
FT                   /protein_id="ADL50012.1"
FT                   /translation="MQSINEGIFGIDVSRWQGNIDWSRVKVAGVNIAIIKASGADDGFY
FT                   EDSRFQTNYQGAIASGIKVGAYHFFTEYEDAIAQAEYFSSLLSGKTWNIKPAIDVESGL
FT                   GDSQLTDKVITFCERVKALTGMDCVIYCNTNYARNAFDSRVAKYPLWVAHYGVDTPGDN
FT                   PIWGQWAGFQYSSDEYIDGITENTVDKNRFTEAMFLNGSVGLSGIQIGEVTASTIAQRE
FT                   TSPTMSGQDAATYIVQGGDTLSAIAEQFGTSWQVLAEINGISNPDLIQIGQALRISKTQ
FT                   NISQGEVSAAIAQGETSAAVAQGGTPLASSGQGTATYIVQGEDTLSTIAEQFGTSWQAL
FT                   AEINGIANPDLIQIGQVLRISKASAIAQGGTSPDSGGQGNTTYIVQGGDTLSAIAQRFG
FT                   TSWESLAQLNGLANPDLIYEGQVLRIG"
     atgcagagta tcaatgaagg aattttcggt atagacgtaa gcagatggca aggaaatatt        60
     gattggagta gggtaaaagt tgctggagtt aatattgcaa taatcaaggc cagtggagca       120
     gatgacggat tttatgaaga ttctaggttc caaacaaact accaaggagc aatagcttca       180
     ggaatcaagg taggagctta tcatttcttt acggaatatg aagatgcaat tgcacaagca       240
     gaatacttct cgagtctttt aagcggaaag acttggaata tcaaaccagc aattgatgtg       300
     gaaagtggtt taggtgattc acaattaaca gataaggtca ttactttctg tgagagagtt       360
     aaggcattga ctggtatgga ttgtgttata tactgcaata caaactacgc aagaaatgct       420
     tttgatagca gagtagcaaa atatccatta tgggttgctc attatggagt agatactcca       480
     ggggataatc caatatgggg acagtgggct ggattccagt atagttctga tgaatacata       540
     gatggaatta ctgaaaacac agtagacaag aatcgattta ctgaagcaat gttcttaaat       600
     ggatcagttg gattaagcgg aattcaaata ggagaagtta cagcctcaac aatagctcaa       660
     agggaaacat ccccaactat gagtgggcaa gatgctgcta catatatagt gcaaggtgga       720
     gatactttaa gtgccattgc tgagcagttc ggaacaagct ggcaagtctt agcagaaatc       780
     aacggaatct ctaatccaga cttaatacaa ataggccaag ctctaagaat ctcaaaaact       840
     caaaatatat ctcaagggga agtatcagca gcaatagctc agggggaaac atcagcagct       900
     gtggctcaag gaggaacacc cttagcttca agcggacaag gtactgctac atatatagtg       960
     caaggtgaag atactttaag taccattgct gagcagttcg gaacaagctg gcaagcctta      1020
     gcagaaatca acggaatcgc taatccagac ttaatacaga taggacaagt tttaagaatc      1080
     tcaaaagcct cagcaatagc gcaaggagga acatctccag attcaggtgg acaaggcaat      1140
     actacatata tagtgcaagg tggagataca ttaagtgcta tagctcaaag gtttggcaca      1200
     tcttgggaaa gtctagcaca attaaatggt ttggctaatc cagatttaat ctacgaggga      1260
     caggtactta ggataggtta a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page