(data stored in ACNUC7421 zone)

EMBL: CP002160.PE222

CP002160.PE222       Location/Qualifiers
FT   CDS_pept        complement(317549..317929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dhd:Dhaf_1132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50013"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG4"
FT                   /inference="similar to AA sequence:KEGG:Dhaf_1132"
FT                   /protein_id="ADL50013.1"
FT                   /translation="MDIKKRVLQFWEDVANQNPIKLQEYFRPDAIINWHNTNESFTVEE
FT                   YIIANCEYPGQWCGEVERLEIIDDLVISVTRIWLSDNSFSAHATSFIRFYDEKIINLDE
FT                   YWGVDEAAPKWRQDKKIGRPIN"
     atggatatca aaaagagagt attacaattt tgggaagatg ttgctaacca aaatcctata        60
     aagcttcaag aatattttag gccagatgca ataattaatt ggcataatac taatgaaagt       120
     tttactgttg aagaatatat aatagcaaat tgtgaatacc ctggtcagtg gtgtggagaa       180
     gttgaaaggc ttgaaataat agatgattta gtgatttcag ttacaagaat atggctttca       240
     gataatagtt tctccgctca cgctacttct tttattagat tttatgatga gaaaataata       300
     aatttagatg agtattgggg tgttgatgag gctgctccta agtggaggca ggataagaaa       360
     attggaagac caataaatta g                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page