(data stored in ACNUC7421 zone)

EMBL: CP002160.PE225

CP002160.PE225       Location/Qualifiers
FT   CDS_pept        320974..321339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_2735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50016"
FT                   /db_xref="InterPro:IPR025438"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG7"
FT                   /inference="similar to AA sequence:KEGG:Clos_2735"
FT                   /protein_id="ADL50016.1"
FT                   /translation="MKINTIKENNVEIAVVNSSDILIKDVQSALDFIGTVGFETGCYHI
FT                   VLNKSSICEDFFNLKTKLAGEILQKFVNYHVKIAIVGDFSVYTSNSLKDFIYESNKGRD
FT                   IFFLPDEKQAIEKLSLA"
     atgaaaataa atactattaa agagaataat gttgaaattg ctgttgtaaa cagtagtgat        60
     atattgataa aggatgttca atcagcgtta gattttatag gaactgtagg gtttgaaaca       120
     ggatgttatc atatagtttt gaataaatca tcaatatgtg aggatttttt taacttaaaa       180
     acaaaacttg caggggaaat attacagaag tttgttaatt atcatgtgaa gatagctatt       240
     gtcggtgatt tttctgtata cacaagtaat agcttaaaag attttattta tgagagcaat       300
     aaaggaagag atattttttt cttaccagat gagaaacaag caattgaaaa attaagtcta       360
     gcataa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page