(data stored in ACNUC7421 zone)

EMBL: CP002160.PE227

CP002160.PE227       Location/Qualifiers
FT   CDS_pept        complement(322703..323359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0234"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /note="KEGG: cbk:CLL_A2809 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50018"
FT                   /db_xref="GOA:D9SPG9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPG9"
FT                   /inference="similar to AA sequence:KEGG:CLL_A2809"
FT                   /protein_id="ADL50018.1"
FT                   /translation="MDKFLKFWKKYSFVGLVAFILLGLLDLRFAIAAIICMVAPIIVSI
FT                   FKGRFWCGNLCPRGNFYDNVVSKFSKKRKVPKFLKSYYFRAVVLILMMTIFTIGIKENW
FT                   GNLYGIGMVFYRMIVVTTIIGVVLSLFYNHRTWCHFCPMGTIASVISKFRKSKNVLHVS
FT                   NSCVSCKLCEKKCPLGIVPYEYKGDVLSHPDCIQCGQCVTSCPRKSIGYEKVTSK"
     ttggataagt tcttaaaatt ttggaaaaag tattcctttg taggtctagt tgcttttata        60
     ttgttagggc tacttgattt gagatttgca atagccgcaa taatttgtat ggtagcgcca       120
     ataattgtgt ctatctttaa agggagattt tggtgcggaa atttatgtcc aagaggaaac       180
     ttttatgata acgtagtttc taaattcagt aagaaaagaa aagtccctaa attcctaaag       240
     tcttattact ttagagctgt agttttaata cttatgatga ctatattcac cattggaatt       300
     aaggaaaatt ggggtaacct ttatggtata ggtatggtat tttatagaat gatcgtggtt       360
     acaactatca ttggagttgt gttatcttta ttctataatc atagaacctg gtgccatttc       420
     tgccctatgg gaactatagc atcggttata tcaaaattta gaaaaagtaa aaatgtatta       480
     catgtatcaa actcttgcgt ttcttgtaag ttatgcgaaa agaaatgtcc attaggaata       540
     gttccttatg aatataaagg tgacgtatta agtcatcctg attgtataca atgtggacaa       600
     tgtgtaactt catgtcctag aaaatcaatc ggctatgaaa aagtaacttc aaaatag          657
//

If you have problems or comments...

PBIL Back to PBIL home page