(data stored in ACNUC7421 zone)

EMBL: CP002160.PE230

CP002160.PE230       Location/Qualifiers
FT   CDS_pept        326103..326657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0237"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="KEGG: bcr:BCAH187_C0209 phosphoglycerate mutase
FT                   family protein; PFAM: Phosphoglycerate mutase; SMART:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50021"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH2"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADL50021.1"
FT                   /translation="MITNIYFVRHANSSYTPDELNRPLSENGVKDAQRVTELLSHENIS
FT                   KVISSPYKRAIQTVEGVSNHFGLSISIDEGFRERKLAEGAVTNFDEVILKYWENFDFCI
FT                   HGGETAYDAQHRGVESLKNVLNRYCGENIVIGTHGNIMVIIMNYYDKKYNYVFWKDLNM
FT                   PDIYKLIFKDNNLVGVEHIWS"
     atgataacta atatatattt tgttagacat gctaattcat catatactcc tgatgaatta        60
     aataggccat tatctgaaaa tggggtaaag gatgcccaaa gggtaacaga attactatca       120
     catgaaaata taagtaaggt tatatcaagt ccgtataaac gtgctattca aacggttgaa       180
     ggcgtatcaa atcatttcgg attatctatt tcaatagatg aaggatttag agaaagaaaa       240
     cttgctgagg gagcagttac aaattttgat gaagtaattt tgaagtattg ggaaaacttc       300
     gatttctgca ttcacggagg tgaaacagct tacgatgccc aacatagagg tgtagagtct       360
     cttaaaaatg ttttaaatag atattgcgga gaaaatattg ttattggaac tcatggaaat       420
     attatggtga taataatgaa ttattatgat aaaaaatata attacgtttt ctggaaagat       480
     ttgaatatgc cagatatata taaattaatc tttaaagata ataatttagt cggtgtagaa       540
     catatttggt catga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page