(data stored in ACNUC7421 zone)

EMBL: CP002160.PE233

CP002160.PE233       Location/Qualifiers
FT   CDS_pept        complement(328626..329099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0240"
FT                   /product="dihydrofolate reductase region"
FT                   /note="PFAM: dihydrofolate reductase region; KEGG:
FT                   ssb:SSUBM407_0957 dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50024"
FT                   /db_xref="GOA:D9SPH5"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH5"
FT                   /inference="protein motif:PFAM:PF00186"
FT                   /protein_id="ADL50024.1"
FT                   /translation="MISLIVAVAKNNVIGNNGIIPWKIKGEQKRFKELTIGKTIIMGRK
FT                   SFEEIGKPLPNRKTILISNTQCIESENCTTVNSLSEAFDLTKDEDEVFVAGGGQVYKES
FT                   FTYADRIYITVIDKIIDGNVYFPEISSDDFIKSYEERIDAEIPYTYYTYERRK"
     atgatttcat taatagttgc ggtagcaaaa aataatgtaa taggaaataa tggtattatc        60
     ccatggaaaa taaagggtga acaaaaaaga tttaaagaat taacgatagg caagacaata       120
     atcatgggaa gaaaatcttt tgaagaaata ggtaagccac tacctaacag aaaaacaata       180
     cttatctcaa atacacaatg tattgaatca gagaattgta caactgtaaa ttcgctttcg       240
     gaagcattcg acttaacaaa ggatgaagac gaagtatttg ttgctggtgg tggacaggta       300
     tacaaggagt catttaccta tgcagataga atatatatta cagttataga taaaattatt       360
     gatggtaatg tatattttcc agagatttct tctgatgatt ttataaaatc ttatgaagag       420
     cgaattgatg ctgaaatacc atatacatat tatacatatg aaagaagaaa ataa             474
//

If you have problems or comments...

PBIL Back to PBIL home page