(data stored in ACNUC7421 zone)

EMBL: CP002160.PE234

CP002160.PE234       Location/Qualifiers
FT   CDS_pept        complement(329800..330150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tad:TRIADDRAFT_62504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50025"
FT                   /db_xref="GOA:D9SPH6"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH6"
FT                   /inference="similar to AA sequence:KEGG:TRIADDRAFT_62504"
FT                   /protein_id="ADL50025.1"
FT                   /translation="MDETAVINALNILGNKFDSLSQIMELDIAQKEAINFNELIIAQLA
FT                   LLASLLMLIGDMLILLSQLKQNEQTLKEEKKLEEYDFAETLSMWVYVLGDYLCLESSLL
FT                   ELKDLKQSSQDE"
     atggatgaaa ctgcagttat caatgctttg aatatacttg gcaataaatt tgattcacta        60
     tcacagatta tggaattaga catagcacaa aaagaagcaa taaactttaa tgaattaatt       120
     attgctcaat tagccctttt agcttcctta cttatgctta ttggcgatat gcttattctt       180
     cttagtcaat taaagcaaaa tgagcaaacc ttaaaagaag aaaagaaatt agaagaatat       240
     gattttgcag aaactctctc tatgtgggtt tatgtactgg gagattatct ttgccttgaa       300
     tccagtttat tagaattgaa ggatctaaaa cagtcttcac aggatgaata a                351
//

If you have problems or comments...

PBIL Back to PBIL home page