(data stored in ACNUC7421 zone)

EMBL: CP002160.PE235

CP002160.PE235       Location/Qualifiers
FT   CDS_pept        330584..331204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_3043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50026"
FT                   /db_xref="InterPro:IPR031343"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH7"
FT                   /inference="similar to AA sequence:KEGG:Cbei_3043"
FT                   /protein_id="ADL50026.1"
FT                   /translation="MKKLKKFFAVLIVSVMSAVMLTACGSTKASPEESAEIFLDVLLKN
FT                   DKSNMDKIGMEEDDYTKFREAIDYGLMEGFAGSISDPNVLTEDIKNTLKENIITGFSKV
FT                   EYKVVSSEIDGDIAKVNVEIKGFDMNTISANIQARLQEDLKANPAMTQPQMLQTSLKYI
FT                   GESIANGVIVQEPKTITLALAKDGNTWLPGENDIVTLMEALVS"
     atgaaaaaat taaaaaagtt ttttgcggta cttatagttt ctgtaatgtc tgcagtaatg        60
     ttgactgcat gtggaagcac aaaagcatca ccagaagaaa gtgctgagat atttttggat       120
     gtattactaa agaatgataa gtctaatatg gataagatag gtatggaaga agatgattac       180
     actaaattta gagaagccat agactatggt cttatggaag ggtttgctgg atcgatatca       240
     gatcctaacg tgttgaccga agatataaag aatactttga aagaaaacat tataactgga       300
     ttttcaaagg tagaatataa agtagtttca tctgaaattg acggtgatat agctaaagta       360
     aatgttgaaa taaaaggttt tgatatgaat actatttctg caaatattca ggcaaggctt       420
     caagaagatt tgaaggctaa tccagcaatg actcagccac aaatgctaca aacatctttg       480
     aaatatatag gagaaagtat tgcaaatggt gtaatagttc aagaaccaaa aactattacc       540
     ttagctttag caaaggatgg aaacacatgg ttaccaggtg agaatgatat tgtgacatta       600
     atggaggcac tagtttcata a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page