(data stored in ACNUC7421 zone)

EMBL: CP002160.PE236

CP002160.PE236       Location/Qualifiers
FT   CDS_pept        331539..331922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0243"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: cby:CLM_0905 putative arsenical resistance
FT                   operon repressor ArsR; PFAM: regulatory protein ArsR;
FT                   SMART: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50027"
FT                   /db_xref="GOA:D9SPH8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH8"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADL50027.1"
FT                   /translation="MKPQYEENAKIIKALSDPSRLKIIDILSCGEKCACEILEEFQFTQ
FT                   PTLSHHMKVLSDCGLVNSRKEGLWNYYSLNNSKCNKLILFLMNLVTDTEECICKDKTED
FT                   DCKTEKKGYCETGIKCDCKLLEN"
     atgaaaccac aatatgaaga aaacgcaaaa attattaaag cactttcaga tccaagtaga        60
     ctaaagatta tagatatttt atcttgtgga gagaagtgtg cttgtgaaat attagaggaa       120
     tttcaattta ctcagccaac cctttcacat catatgaagg ttttaagtga ttgcggcctt       180
     gttaatagca ggaaagaggg actttggaat tattattctc taaacaactc aaagtgtaac       240
     aagcttatat tatttcttat gaatcttgtt acagatacag aggaatgcat ttgtaaggat       300
     aaaactgagg atgattgtaa aaccgaaaaa aaaggttatt gtgaaactgg aataaaatgt       360
     gattgtaagc tgctagagaa ctag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page