(data stored in ACNUC7421 zone)

EMBL: CP002160.PE240

CP002160.PE240       Location/Qualifiers
FT   CDS_pept        334059..336245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0247"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ckl:CKL_3639 signal transduction histidine
FT                   kinase component; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS domain containing protein; histidine kinase
FT                   HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50031"
FT                   /db_xref="GOA:D9SPI2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPI2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL50031.1"
FT                   /translation="MFKKSKLSKELGRNRLDRNFLKKGPKLIQRKKGNRINVLELNKNI
FT                   SLKITFGFLAIVIVSTLFIGIIAINIFKNNIYEIKENNMRKHAQAISETLEPYMKNPQS
FT                   SNGLNEIMHLIYHIDNARIWVLNPNKTIVTASDKSNAITYVNDTEVNEVYKDINERVLL
FT                   GEQGYILAYNPYYEEDMMTIAVPIKNDNKVIGAVVVNSPIYDLINSMDKFFIYIILILG
FT                   IEIIIVGFMGYYFSNSISKPIRKINESALKLARGHYGIKTNIYQKDEIGELSSSFDLLS
FT                   LKLEYTIGKLFEEKNKLSNIIKSISEGLLALDTDMKLIDINEAAIKLLGIDDKDAKQLL
FT                   PISNENYEATEKLSEVNNISDEAVEKVSSINNANDDVAKKSPVINNANNDVDKKLSVIN
FT                   NASDEETEKLSAVKNSSATTKIEEPKEDSTKYHIEIMEIFQQLNLIEALGLKDIQEKKS
FT                   VIKNFKNKILDFSIAPIRKSSNEIIGGVILIQDISEKEKLEQLRKDFISNVSHEFRTPL
FT                   TVIKGNLESIVDGITRPEDVMETCINLIKETNRLERMVKDLLNLSKLESGTLELEVSDL
FT                   DVNLLINDTIRSLRPLIRDKNIAIELSLQEDLSILQSDYYKLKQLLIIFIDNSIKFSSK
FT                   GGVVKVDTYSKDKELYIAIKDNGIGIPQEEIQYLGEKFYKADKARNATVEGTGLGLSIA
FT                   KRLVKVLNGTFKVESQVNQGTRIIISFPISKNSD"
     atgtttaaga agagtaagtt aagcaaagaa ttagggagaa ataggttaga cagaaatttt        60
     ttaaaaaaag ggcctaaact gattcaaagg aaaaagggta ataggattaa tgtattagag       120
     ttaaataaaa acattagcct taaaataacc tttggctttt tagcgatcgt aatagtttct       180
     actcttttta taggcatcat cgctataaat atttttaaaa ataacatcta cgaaatcaaa       240
     gaaaataata tgagaaagca tgctcaagca atttcagaaa ccttagagcc ttatatgaag       300
     aatccacaaa gtagcaacgg acttaatgaa attatgcatt tgatatatca cattgataac       360
     gcaagaatat gggtgttgaa tcctaataaa accatcgtca ctgcttcaga taagtctaat       420
     gccattactt atgtcaatga cacagaggta aatgaagtat ataaagatat caatgaacga       480
     gtactattag gggaacaagg ctatatttta gcctacaatc cttattatga agaagacatg       540
     atgaccatag cagtaccaat aaagaatgat aacaaagtta taggtgcagt agtagtaaat       600
     tctcctatat atgatttgat aaattctatg gataaattct ttatatatat aattttaatt       660
     cttggcattg agataataat tgttggtttt atgggttact atttctcaaa tagtatttct       720
     aaaccaataa gaaaaataaa tgaatcagcg ttaaaactag cacgggggca ctatggaata       780
     aagacaaata tatatcaaaa ggatgaaata ggggagttgt ccagttcctt tgatttacta       840
     tctttaaagc tagaatatac tataggcaag ctatttgaag aaaaaaataa gttaagcaac       900
     ataataaaaa gtatcagcga agggctttta gctttagata cagatatgaa gcttattgac       960
     ataaacgaag cagctataaa gctattaggt attgatgata aagatgctaa acagctatta      1020
     ccaattagca atgaaaatta cgaggcaacc gaaaagttat cagaagttaa taatataagc      1080
     gatgaggcag tagaaaaggt atcatcaatc aataatgcaa atgatgatgt agctaaaaag      1140
     tcaccagtaa tcaataatgc aaataatgat gtagataaaa agttatcagt aattaataat      1200
     gcaagtgatg aagaaactga aaaattatca gcagttaaaa attcatcagc caccactaag      1260
     attgaggaac ctaaagaaga tagtactaag tatcatatag aaattatgga gatttttcag      1320
     cagttaaatc ttatagaagc tcttggacta aaagatatac aggagaaaaa atccgttata      1380
     aaaaacttta aaaacaagat tcttgatttt tctatagctc caataagaaa gagttcaaat      1440
     gaaattatag gtggagttat ccttattcaa gatataagcg aaaaagaaaa actagagcag      1500
     ctaaggaagg actttatttc aaatgtttct catgaattta gaactccttt gacagttata      1560
     aaaggtaatc tggaatctat tgtagatgga atcactagac cagaggatgt gatggaaaca      1620
     tgcattaatc tgataaaaga aacaaatcga cttgaaagaa tggttaagga cttattaaat      1680
     ttaagcaaac tagaatcagg tactttagaa cttgaggttt cagaccttga tgtgaatttg      1740
     cttattaatg acactataag aagcctaaga ccacttataa gagataagaa tatagctatt      1800
     gaattatcac ttcaagaaga tttgtcgatt cttcaaagcg attactataa attaaaacag      1860
     ctactaataa tttttataga caatagtata aagttttcga gcaagggtgg agttgtgaag      1920
     gttgacactt actcaaagga taaagagctg tatatagcta taaaagataa tggaattggc      1980
     ataccacaag aagaaattca gtatttagga gaaaagtttt ataaggcaga taaagcaaga      2040
     aatgcaacgg ttgaagggac agggttagga ctttcaatag caaaacgatt agttaaggtt      2100
     ttaaatggaa catttaaagt agagagccaa gtaaatcagg gaactaggat aattatttct      2160
     ttcccaataa gtaagaattc agattag                                          2187
//

If you have problems or comments...

PBIL Back to PBIL home page