(data stored in ACNUC7421 zone)

EMBL: CP002160.PE246

CP002160.PE246       Location/Qualifiers
FT   CDS_pept        340479..340703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckl:CKL_0611 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50037"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPI8"
FT                   /inference="similar to AA sequence:KEGG:CKL_0611"
FT                   /protein_id="ADL50037.1"
FT                   /translation="MSFFSSSSGRGHYGGMHQGRGYYRREGLFMKLLRLLGVLSSSARG
FT                   HNRIHSHSSYHNNHFNHGYHRRRHKSSWS"
     atgagttttt tttcaagttc atcaggtaga ggacactatg ggggtatgca tcaaggtaga        60
     ggttattaca gaagagaagg gcttttcatg aagttactta ggcttttagg ggtgttatct       120
     agttctgcta ggggacataa tagaatacat tctcatagtt catatcataa taaccatttc       180
     aatcatggat atcacagaag aaggcataaa agttcatggt catga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page