(data stored in ACNUC7421 zone)

EMBL: CP002160.PE247

CP002160.PE247       Location/Qualifiers
FT   CDS_pept        340694..341437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0254"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine-protein kinase-like domain;
FT                   KEGG: ckr:CKR_0539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50038"
FT                   /db_xref="GOA:D9SPI9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPI9"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADL50038.1"
FT                   /translation="MVMIDFFKKKIYPPGFLLGGYKILSTIGEGRFGICYLAELDDKQY
FT                   VLKVIKPNAIKKSGNKLIFEERILSSIDNPAIPKILEVIKTDEIHVYVLEYKKGRTLEE
FT                   MIFDDGHVFSRCEIYKVGIALINIIKYLHERNIVHRDIRVPNVVIDEDEVYLIDFGLAR
FT                   LVDNDRYIPNIDFRCLGHLLIHLYYSSFDGTNKKSGPWYEELELSQKELIFLKKLLGLK
FT                   RKYMSIDDVEHDFEKIFPREDIVSK"
     atggtcatga ttgacttttt taagaagaaa atatatccac caggcttttt gcttggtggg        60
     tataaaatat taagtaccat aggagaaggt cgctttggaa tatgttattt agcagagtta       120
     gatgataagc aatatgttct aaaggtaatc aagcctaatg ctattaaaaa aagtggaaat       180
     aagcttattt ttgaggagag aatactttca tctattgata atccagccat ccctaaaata       240
     ttagaggtaa taaaaactga tgaaatacat gtatatgttt tggaatataa aaaaggaaga       300
     actttagaag agatgatttt tgatgatgga catgtgttta gccgatgtga gatctataag       360
     gttggaatag cgcttataaa cattattaag tatcttcatg aaaggaatat agtacatagg       420
     gatataagag tacctaatgt ggttatcgat gaagatgaag tatatcttat cgattttggt       480
     cttgcaagat tggttgataa cgacaggtat ataccgaata tagattttcg ttgtttagga       540
     catctactta tccatctata ttactcatct tttgatggaa caaacaagaa atcaggacct       600
     tggtatgaag agttggaatt aagtcaaaag gaattgatat ttttgaaaaa acttttggga       660
     cttaagagaa aatacatgag catagatgat gttgagcatg attttgagaa aatatttcca       720
     cgagaggata tagtatcaaa atag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page