(data stored in ACNUC7421 zone)

EMBL: CP002160.PE249

CP002160.PE249       Location/Qualifiers
FT   CDS_pept        complement(343042..343911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0256"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: lmc:Lm4b_02671 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50040"
FT                   /db_xref="GOA:D9SPJ1"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPJ1"
FT                   /inference="protein motif:PFAM:PF01418"
FT                   /protein_id="ADL50040.1"
FT                   /translation="MNIFSKLNKLTNLTENEKTLVSYMQDNPEGFVKMSALEISDACFI
FT                   STSTIYRLCQKLDLSGLSELKVQISLSINEYLKEQSSLDYNYPIKQNETQHQIVLKLKE
FT                   LYEQTLVSSLNLIDLEQLRLIANVLKNAQHIDFYTSAGNMYFVENFKFQMQEIGTFINV
FT                   PIEEYHQLLTASTSDENHIAIVVSFEGRGVIIKRIADMLKVNKTPIILISSTNENPLTK
FT                   YANYHLYLSSNENHFNKISSFSTRLSLLYVLDCLYTCYFNLNYDKNVSYKLNAYKKLSG
FT                   NFNKTPET"
     atgaacattt tcagtaaatt aaataaactt acaaacttaa ctgaaaacga gaaaacatta        60
     gttagctata tgcaagataa tcctgaaggt tttgtgaaaa tgagtgctct tgaaattagt       120
     gacgcctgct ttatttcaac ttcgactatt tatagactct gtcaaaagtt agatttatca       180
     ggactatcag aattaaaagt acaaatatct ctgtctatta atgagtattt aaaagaacag       240
     agttctttag attataacta tcctattaag caaaatgaaa cccaacatca aattgtattg       300
     aaattaaagg aattatatga acaaacttta gtgtcttcat taaatttaat agacctagaa       360
     caattgagat taatagctaa tgtattaaaa aatgcacagc atattgattt ttacacctcc       420
     gctgggaata tgtattttgt tgagaacttt aaatttcaaa tgcaagaaat cggaaccttt       480
     atcaatgttc caatagaaga ataccatcaa cttttaacag cctctaccag tgatgaaaat       540
     catatagcaa tagtagtttc ctttgaaggt agaggtgtaa taataaaaag aatagcggat       600
     atgctaaaag taaataaaac tccaattatt ttaatttctt caacaaacga aaatccgctt       660
     actaaatatg caaattacca tttgtattta agttcaaatg aaaatcactt taataaaatt       720
     tcatcttttt caacaagatt atccttgtta tatgttttag attgtctata tacatgctat       780
     tttaacttaa actacgacaa aaacgtaagt tataagctta atgcatacaa aaaattatct       840
     ggtaacttta ataaaactcc tgaaacataa                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page