(data stored in ACNUC7421 zone)

EMBL: CP002160.PE25

CP002160.PE25        Location/Qualifiers
FT   CDS_pept        complement(51391..52884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0027"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: cce:Ccel_0493 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49816"
FT                   /db_xref="GOA:D9SMN1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN1"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL49816.1"
FT                   /translation="MNTETSISYNIKTVHLVNITVIVILSLLLFGLAYVGLGLSYALFV
FT                   LAQNSVIWAIVAAIYFSKINDNIKAMIFSLIPLLTGAAAFLKATSTPLGNHYFIFLSIA
FT                   MIALYFNNKLIAIHQVLTNLTYILLYIISGPRLLIDPNGTIWSFIYILVCANGVLALLY
FT                   FLTKWGKALVTEAVRKEKVAGELSLKLNASLEEIKKGSTLLNNTIIDFDKNISSSKEAI
FT                   SNMNIAMQEMASGVSEQAENLSSINEKMNIATENVLKTEKISSNVSTESSKMSEQVIEG
FT                   SSKIKEMNTQMDIIYQAVNTSFNTVSDLETRIIEINQYLNSINEIAEQTNLLALNAAIE
FT                   SARAGEHGKGFAVVAEEVRKLAEQSSTTVKDINTIINTINEQTKLVVDKVKLGDTAVES
FT                   GKKLIAEVNDNFTVIADNFIKTNRLLDEGAKVSSETSKEFMAMLEKVNSIAAISEQQAA
FT                   TIEELSATAENTNADIIMISDSVNEIKNLSNSLDMMSIK"
     atgaatactg aaacatctat aagctacaat ataaaaaccg tacacctagt aaacataaca        60
     gtaatagtaa tattgtcttt gttacttttt ggtctagcat acgtaggact tggactttca       120
     tacgcactgt ttgttcttgc tcaaaattca gttatttggg caatagtcgc agcaatttat       180
     ttttctaaaa ttaacgataa tattaaggct atgatttttt ctttaatccc tctacttact       240
     ggagctgcag catttttaaa agctacgagt accccactag ggaaccacta ttttatcttt       300
     ttatcaatag ctatgatagc cttatatttt aacaacaaat taatagcaat tcatcaagta       360
     cttactaact taacgtatat tctattatat ataatcagcg gacctagatt attaattgat       420
     cctaatggta ctatttggtc atttatctat atacttgttt gtgctaatgg agttctagct       480
     ttattatatt ttcttacaaa gtggggaaaa gcattagtta ctgaagctgt aagaaaagaa       540
     aaggttgcag gagaactttc tttaaaacta aatgcatcat tagaagaaat taagaaaggg       600
     tcaacacttt tgaataatac tattatcgat tttgataaaa atatatcttc ctctaaagaa       660
     gctatttcaa acatgaatat agctatgcaa gaaatggcta gtggagtcag tgaacaagct       720
     gaaaatttaa gtagcatcaa tgaaaaaatg aatatagcta cagaaaatgt attaaaaact       780
     gaaaaaatat caagcaatgt aagtactgaa tcttctaaaa tgtcagaaca agtaatagaa       840
     ggttcttcta agattaaaga aatgaatact cagatggata taatatatca ggcagtaaat       900
     acatctttta atacagtttc tgatcttgaa actagaataa tagaaataaa ccaatacctt       960
     aacagtataa atgaaattgc tgaacaaact aatcttttag cattaaacgc agcaatcgaa      1020
     tcagcaagag ctggcgaaca tggcaaaggc tttgctgtcg ttgctgaaga agttcgaaaa      1080
     ttagctgagc aaagttcaac aacagtaaaa gatataaata caataataaa taccataaat      1140
     gaacagacaa aactagtagt agataaggtt aaactcggag atactgctgt tgaatctggt      1200
     aaaaaattaa ttgcagaggt aaatgataac tttacagtaa tagcagataa cttcatcaaa      1260
     actaatcgac ttctagacga aggtgccaaa gtaagtagcg aaacttcaaa agagtttatg      1320
     gctatgctag aaaaagtcaa ttctatagcg gctatttctg agcaacaagc tgctaccata      1380
     gaagaattat cagctacagc agaaaatact aatgcagata ttatcatgat tagtgattct      1440
     gtaaatgaaa ttaagaattt aagtaactcc ttagacatga tgtcaataaa ataa            1494
//

If you have problems or comments...

PBIL Back to PBIL home page