(data stored in ACNUC7421 zone)

EMBL: CP002160.PE252

CP002160.PE252       Location/Qualifiers
FT   CDS_pept        345602..345922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0259"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: cbe:Cbei_1451 rhodanese domain-containing
FT                   protein; PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50043"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPJ4"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADL50043.1"
FT                   /translation="MLGFLKKNDGKAINVNDIDNLIGKVELIDIREEYEYKGGSIKGSK
FT                   NIPMGELLGDPDKYLDKNKEYYIMCQSGGRSSKTCNVLSKQGYDVVNVSGGMGSYAGTK
FT                   RE"
     atgttaggat ttctaaagaa aaatgatggg aaggccatta acgttaatga cattgataat        60
     ttaattggaa aggtagaact aattgatatc agagaagaat acgaatataa aggtggaagt       120
     ataaagggct ctaaaaatat cccaatggga gaattgcttg gggacccaga taaatattta       180
     gataaaaaca aagaatatta cataatgtgc cagtcagggg gaagaagttc aaagacttgc       240
     aatgttcttt caaagcaagg ctatgatgtt gttaatgttt ctggtggaat ggggtcatat       300
     gcaggtacaa agcgagaata a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page