(data stored in ACNUC7421 zone)

EMBL: CP002160.PE27

CP002160.PE27        Location/Qualifiers
FT   CDS_pept        complement(55164..56021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0029"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: gym:GYMC10_3909 transcriptional regulator,
FT                   AraC family; PFAM: Cupin 2 conserved barrel domain protein;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49818"
FT                   /db_xref="GOA:D9SMN3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN3"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADL49818.1"
FT                   /translation="MAEMKLSYFTNDEGFPFFIQYGYHSNNLSIHTHTDFSELVIVMNG
FT                   TATHIVDNEKFNIKKGDVFVINSNTCHGYENAKDFRICNIMYRSENLLLADYDIKKNAG
FT                   FHALFVIEPYFTKEHSFKSNLTLKPLDFEKIHILLDSLLSEYMTKTDGWKTSTKALFML
FT                   LVVTLARLYDFGNSSEKVDVINIAKSISYIENHYTEDISIDLLAKISHYSPRHFARIFS
FT                   ETYSTTPLNYIISLRIRRACSLLKETTLPISTIAIQCGFSDSNYFSRIFKKNLYLTPKQ
FT                   YRTS"
     atggccgaaa tgaaacttag ttattttaca aatgatgaag gttttccatt ttttattcag        60
     tatggctacc atagtaataa cctttctatt catacacata ccgatttttc tgaacttgtc       120
     attgtaatga acggtaccgc tactcacatt gttgataatg aaaaattcaa tattaaaaaa       180
     ggagatgttt ttgttattaa cagcaacacc tgtcatggat atgaaaacgc taaggatttt       240
     cgtatttgca atataatgta tcgttctgaa aatttacttt tggctgatta cgatattaaa       300
     aaaaatgcgg gtttccatgc gctatttgta atagaaccct atttcacaaa agaacatagc       360
     ttcaaaagca atttgacatt gaagccgtta gattttgaaa aaattcatat tttattagat       420
     agtttgcttt ctgaatatat gactaaaact gatgggtgga aaacatccac aaaagcactc       480
     tttatgcttt tagttgtaac ccttgctcga ctatatgatt ttggaaatag ctccgaaaag       540
     gtagatgtaa tcaacatagc caagtctatt tcatatattg aaaatcatta tacagaagat       600
     atctccatag acttactcgc aaagatttct cactactccc caagacactt cgcaagaatt       660
     tttagtgaaa cctatagtac tacaccccta aactacatta tttcactaag aatacgtcgt       720
     gcttgtagcc tacttaagga aactacactt cctatatcaa ctatagctat tcaatgtggc       780
     ttcagtgata gtaattactt cagccgtatt tttaagaaaa acttatacct taccccaaag       840
     caataccgaa catcttaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page