(data stored in ACNUC7421 zone)

EMBL: CP002160.PE270

CP002160.PE270       Location/Qualifiers
FT   CDS_pept        366350..366880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_2708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50061"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL2"
FT                   /inference="similar to AA sequence:KEGG:BcerKBAB4_2708"
FT                   /protein_id="ADL50061.1"
FT                   /translation="MLKRCIMIFPKFENGQVIDKIREKYDPLVTHVRPHITLVFPFDSN
FT                   IKTNELKNHISLVLSEVETFEVILKGITPVSSFGKYLFLNIEKGTEEIIQLHKKLYTGI
FT                   LEEHFPEWLKGNNFLPHMTVGSFQKEEEFQMAAEETKAVVDAFRTIVTAVSVEIIDENE
FT                   DSIIELEIPLKAI"
     atgttaaaaa gatgtattat gatttttcca aagtttgaaa atgggcaggt aatagataaa        60
     attagagaaa agtatgatcc ccttgtaacc catgtaagac cacatataac tttagttttt       120
     ccttttgata gtaatataaa aacaaatgaa cttaagaatc acatttcatt agttctatct       180
     gaggttgaaa cctttgaggt tattcttaaa ggaattacac cagtgagttc ttttggaaag       240
     tatttgtttc taaatataga aaagggaaca gaagagatta tccaattaca taagaaattg       300
     tatactggga ttttagaaga gcattttcca gagtggttaa agggaaataa cttcttacca       360
     catatgactg taggaagttt tcaaaaggaa gaagagtttc aaatggcagc agaggagact       420
     aaagctgtgg ttgatgcttt tagaaccatt gtaactgccg ttagtgtaga aattattgat       480
     gaaaatgaag attcaattat agaattggag attccgttaa aagctatata a                531
//

If you have problems or comments...

PBIL Back to PBIL home page