(data stored in ACNUC7421 zone)

EMBL: CP002160.PE271

CP002160.PE271       Location/Qualifiers
FT   CDS_pept        complement(367073..367834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0281"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: ftw:FTW_1051
FT                   UbiE/COQ5 family methlytransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50062"
FT                   /db_xref="GOA:D9SPL3"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL50062.1"
FT                   /translation="MKNQEKFDMTKSRFENLFEEKLSYERQTRDDDHLSKIINALKFQN
FT                   SDKLMDLGTGTGYIAFTLAKENPNLQIVGLDIVTNALKANTEKAVKEQLDNITFVEYNG
FT                   MNIPFQDNTFDCIVTRYAMHHFTEIEKSFKEIYRVLKPGGQLFISDPTPNERDENRFVD
FT                   DFMKLSKDDGHIQFYKKEELETMASTAGFKIDDYFMTEIRFPSSSRTEGYRKIEHELPI
FT                   SIKESYDIEIINEEVYITEKVLNISFLKPLA"
     atgaaaaatc aagaaaagtt tgatatgaca aagagcagat ttgaaaatct atttgaagaa        60
     aagctttcct acgaaagaca aactcgagat gatgatcatt tatcaaaaat aatcaatgct       120
     ttgaaatttc aaaatagcga taaactcatg gatttaggta ctggaacagg ctatatcgca       180
     tttactttag ctaaagaaaa tcctaacttg caaatagttg ggctagatat tgtaacaaat       240
     gcattaaaag ctaatactga aaaagcagtt aaagagcagc tagacaacat aacttttgtt       300
     gaatataacg gtatgaatat tcctttccaa gacaatacct ttgattgtat cgttacacgt       360
     tatgctatgc accacttcac agaaattgaa aagagcttta aagaaattta tcgtgtgttg       420
     aagcctggtg gtcaactctt tatctctgac ccaactccaa atgaacgcga tgaaaataga       480
     ttcgtagatg attttatgaa attatctaaa gatgatggcc atattcaatt ttataaaaaa       540
     gaggaacttg agacaatggc ttctactgca ggattcaaaa tagatgatta ttttatgaca       600
     gaaatccgat ttcccagtag ttccaggaca gaaggttaca gaaaaataga acatgaatta       660
     ccaatctcta tcaaggaaag ctacgatatt gagattatta atgaagaagt ttatatcaca       720
     gaaaaggtgt tgaatatttc atttttaaaa cccttggcct aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page