(data stored in ACNUC7421 zone)

EMBL: CP002160.PE272

CP002160.PE272       Location/Qualifiers
FT   CDS_pept        complement(367871..368401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0282"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   oih:OB0922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50063"
FT                   /db_xref="GOA:D9SPL4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL50063.1"
FT                   /translation="MLFKNIETERLLLRNIDIEDRDFIFSMFSDDTVNRYLFDADPLTK
FT                   IKEADEIIEFYMKPEPRLQHRWIIIRKSDGVKMGTCGFHFWQKDSNKVEISCDLKEEFE
FT                   TNGYMQEAFKEIISFAKTDMLIKEITASIYVANERAIKLIESLGFVLSDSRYEVFRKNK
FT                   YLHKIYSLNLEVS"
     atgttattta aaaatatcga aacagaaaga ttactactaa gaaatataga cattgaagac        60
     agggatttta tatttagtat gttctcagat gatacagtta atagatatct ctttgatgca       120
     gatccattaa ctaagattaa agaggctgat gaaataattg agttctacat gaaaccagaa       180
     ccccgccttc aacatcgttg gattattatt agaaagtctg atggtgttaa aatggggacc       240
     tgcggatttc atttttggca gaaagactct aataaagttg aaattagttg tgacttaaag       300
     gaagagtttg agacaaatgg ttatatgcaa gaagctttta aggaaattat ttcattcgca       360
     aaaactgata tgctaataaa agaaataact gcatctatat atgttgctaa tgaaagagca       420
     ataaaactta tagagtcttt aggatttgtt ttgtcagatt cccgttatga agtgttccga       480
     aaaaataaat acctacacaa aatatattcc cttaacctag aagttagtta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page