(data stored in ACNUC7421 zone)

EMBL: CP002160.PE276

CP002160.PE276       Location/Qualifiers
FT   CDS_pept        complement(370982..371677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0286"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="KEGG: cbe:Cbei_2693 HAD family hydrolase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50067"
FT                   /db_xref="GOA:D9SPL8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL8"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ADL50067.1"
FT                   /translation="MIFFDLDGTLIDHKQAEILGVHGFLHEYKEYFNFKEDLFYEHWCK
FT                   ISNKHFARFLNRDISFLQQQIERIKDVFILSGIKLSDNEAAKKFKVYLELYEENLMPYD
FT                   DVLPCLNSLKDKRLGIISNGALKQQLLKLSKIGNEICFDPIIVAEEVGVAKPNIDIFRI
FT                   ACIKANVQAKDCIYVGDDFKTDILSCSTADMNGIWLNRYNQESINSTTKMIQDLRMLKN
FT                   YLQINSIEL"
     ttgatttttt tcgatttaga tggaacctta attgatcata agcaagcaga gattttaggt        60
     gttcatggct ttcttcatga atacaaggaa tacttcaact tcaaggaaga tttattttac       120
     gagcattggt gtaaaatatc taataaacat tttgcacggt ttttaaacag agatatttca       180
     tttctacaac aacaaattga aagaataaaa gatgtattca tactatctgg tatcaagcta       240
     tctgataatg aagctgctaa aaagtttaaa gtctacctag agttatatga agaaaatctt       300
     atgccttatg atgatgtgct tccttgctta aactcactta aagacaaaag attaggaata       360
     atcagcaatg gagctttaaa acaacagcta cttaaactta gcaagatagg aaatgaaatt       420
     tgttttgacc cgattatagt tgctgaggag gtaggagttg caaaacccaa tatcgatata       480
     tttagaatag cttgcattaa agcaaatgtc caagctaaag attgtattta tgttggtgat       540
     gattttaaaa cagatatttt atcttgcagc acagcagaca tgaatgggat ctggctaaat       600
     agatacaatc aagaatcaat caattccaca acaaagatga tacaagattt aagaatgtta       660
     aaaaattact tacagataaa cagtattgaa ctgtag                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page