(data stored in ACNUC7421 zone)

EMBL: CP002160.PE28

CP002160.PE28        Location/Qualifiers
FT   CDS_pept        56147..57478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0030"
FT                   /product="Xylan 1,4-beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /note="KEGG: family 43 glycosyl hydrolase; PFAM: glycoside
FT                   hydrolase family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49819"
FT                   /db_xref="GOA:D9SMN4"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN4"
FT                   /inference="protein motif:PRIAM:3.2.1.37"
FT                   /protein_id="ADL49819.1"
FT                   /translation="MPNPYLPLWEYIPDGEPRVFGERIYVYGSHDNAGSDKFCDFKLKV
FT                   WSAPLDDLNNWTCHGHIFHTRDDRDHKSDTPWTDGDLYAPDVVQKDGKYYLYAYIMGAK
FT                   GCVAVSDRPEGPFELLSKYKYEVVEGEGNDSFNGGWFIDPGVLVDDDGRVYVYCGYESS
FT                   FVAEINPDNMYEIIDGTYQKDIIPIEEPFRFFEACSPRKIEDTYYLIYSPRVGSRLVYA
FT                   TSKSPTGPFEYRGVIVDNGVNYPGGNNHGSICNINNQWYIFYHRMTNGTVMSRRACVEK
FT                   IELLSDGTIPEVEMTSLGFENSLSPYKMTPAEIACVLKGGCFITERNLASRPVTAIISG
FT                   CIIGYKYFDFGEDFSTETMKFSAVVKGTGCKAKIKILLDDYENGEEIGVCEIGADDGVY
FT                   TAIVKNVTGRHALYFLVEDSFGGWFTDMFKGRHLFELESFVFMK"
     atgccaaatc catatcttcc attatgggag tatattcctg atggggaacc tagggttttc        60
     ggtgaacgta tatatgttta tggttcccac gataatgcag gttcagataa attttgtgac       120
     tttaaactta aagtatggtc agcaccacta gatgacttga ataattggac ttgtcatgga       180
     cacatctttc atacaagaga tgaccgtgac cataaatcag atactccatg gacggatggt       240
     gatttatatg cacctgatgt cgttcaaaaa gacggtaagt actaccttta cgcatatata       300
     atgggagcca agggttgtgt tgctgtaagt gataggccag aaggaccttt tgaacttctt       360
     tcaaagtata aatatgaagt tgtagagggt gagggtaacg attcttttaa tggcggttgg       420
     ttcatcgatc caggggtact tgttgatgat gatggaagag tatatgttta ttgtggttat       480
     gaaagttctt ttgttgcaga aattaaccct gataatatgt atgaaatcat tgatggaaca       540
     tatcagaagg acatcattcc aatagaagag ccatttagat tttttgaagc ttgctcacca       600
     aggaaaatag aggatacgta ctatttgata tactctccaa gagtaggaag tagactagtt       660
     tacgctacgt caaaatcacc aacaggacca tttgaatata ggggagttat tgttgacaat       720
     ggggttaact atccaggtgg caacaatcat ggttcaattt gtaatataaa caatcagtgg       780
     tatattttct accaccgtat gacaaatggt acagttatgt caagacgtgc ttgcgttgaa       840
     aagatagaac ttttgtctga tggaacaatc ccagaagttg agatgacatc tcttggtttt       900
     gaaaattctc tttctccata taaaatgaca ccagcagaaa ttgcttgtgt actaaaaggt       960
     ggttgcttta ttacagaaag aaatttagcg tcaagacctg ttacagcaat cataagtgga      1020
     tgtattatag ggtacaagta ttttgatttt ggcgaagact tttcaactga aactatgaaa      1080
     tttagtgctg tagtaaaagg tacaggttgt aaagcaaaaa taaaaatttt acttgatgat      1140
     tatgaaaatg gagaagaaat aggcgtttgt gagataggtg ctgatgatgg cgtttatacc      1200
     gcaattgtaa agaatgtaac tggaagacat gctttatatt tccttgttga agatagtttt      1260
     ggtgggtggt ttactgatat gttcaaaggt agacacttat ttgaacttga atcttttgtc      1320
     tttatgaaat aa                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page