(data stored in ACNUC7421 zone)

EMBL: CP002160.PE281

CP002160.PE281       Location/Qualifiers
FT   CDS_pept        complement(374520..375920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eel:EUBELI_01889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50072"
FT                   /db_xref="GOA:D9SPM3"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM3"
FT                   /inference="similar to AA sequence:KEGG:EUBELI_01889"
FT                   /protein_id="ADL50072.1"
FT                   /translation="MDGSMIFISIFSIVIFSIFYAIGSYINALSNKGIFFGVRMPLGYE
FT                   KHENLLALKKDYTKRFNISFLIFVLVYAITIFLFKDYVFSTFFIAIFALLLLIHNNFYT
FT                   IHKKVRQIKKEEVWKFESRKVVVVDLKGRKNTSENKTLSKGLYFILAAIVLVSFIIAFR
FT                   EDIIFLAIAQIVTTLVMLLAIYAINNTKQQLNGGEANELIEKNKRYKYYISLLMYIASL
FT                   AVTLSFFFVILASADFISSPVIFISIIATTFIPMIIIVIGALLIGQGGKNLSVNSVNDE
FT                   DKLIIDRDDDENYVLGCFYYNKNDPAVFVPKRIGIGTDLNYAKPGSKIFIGIVLAILIG
FT                   SLISTFSLSHLVSTGVKEKSITIEANELSIEGMYGIKIPYESIYSIEMMETFPQDMTRK
FT                   NGLAINHTLIGKFKSKAYDNCNLYIMDSRKPNLFIYTKEEKRIFINYENPDRTRELYDK
FT                   IIEKIHNN"
     atggatggtt caatgatttt tatcagtatt tttagcattg ttattttttc aattttctat        60
     gccataggct catatatcaa tgccttaagc aataaaggaa tatttttcgg agttagaatg       120
     cctcttggtt acgaaaagca cgaaaatcta ctagccttaa aaaaagatta tacaaagcgt       180
     tttaatataa gcttcttaat tttcgtatta gtttatgcta taacaatttt tttgtttaaa       240
     gactatgtct ttagtacttt ttttatagct atctttgctt tgttactctt gatccataac       300
     aacttctata ctattcataa aaaagttaga caaataaaaa aagaagaggt ttggaagttt       360
     gagagcagaa aagttgtggt ggtagactta aaaggaagga aaaatacttc agaaaataaa       420
     actttaagta agggcttata ttttattcta gcagcaattg ttcttgtaag ttttataata       480
     gcatttagag aagacataat tttccttgct attgcacaaa tagtcactac attagttatg       540
     ttattagcaa tctatgctat aaataatact aaacaacaat taaatggcgg agaagctaac       600
     gagcttattg aaaaaaataa acgatacaaa tattatattt ccttattaat gtatatagct       660
     tcattagctg ttactttaag ctttttcttt gtgattttag cctctgcaga tttcatatca       720
     tcaccagtga tttttataag cataattgct actactttta ttccaatgat cataattgta       780
     attggtgctt tattgatagg ccaagggggt aaaaatctat ctgttaacag tgttaatgat       840
     gaagacaagc tcattataga tagagatgat gatgaaaact atgttcttgg ttgtttctat       900
     tataataaga atgacccagc tgtgtttgtt ccaaaacgaa ttggtatagg cactgacctt       960
     aactatgcaa aacctggttc aaaaatattt ataggtattg tcttggcaat cttgataggt      1020
     tcattaatct caaccttttc tttatctcac cttgtgagta caggtgtaaa agaaaaatca      1080
     attactattg aagctaatga gctttctatt gagggtatgt atggaattaa gattccttat      1140
     gaaagtatct atagtataga gatgatggag accttccctc aggatatgac tagaaaaaat      1200
     ggactggcaa taaatcatac attgataggt aaatttaaaa gcaaggcata tgacaattgc      1260
     aatttataca taatggatag ccgcaaacca aacttattta tatatacaaa ggaagaaaaa      1320
     cgtatcttta taaattatga gaatcctgat agaacaagag agttatacga taaaatcata      1380
     gaaaaaattc acaataatta a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page