(data stored in ACNUC7421 zone)

EMBL: CP002160.PE282

CP002160.PE282       Location/Qualifiers
FT   CDS_pept        complement(375922..376305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0292"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: cac:CAC0599 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50073"
FT                   /db_xref="GOA:D9SPM4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM4"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADL50073.1"
FT                   /translation="MLIEINFESDIPIYTQLRNEILRGIASGKLAEGEILPSVRQLASD
FT                   IGINMHTVNKAYNILKQEGFLTIDRRKGAVINTKNLRYKKETLINMEKELNPIIAEGIC
FT                   CDISKNDFIEMINKIYDDYKVEE"
     atgctaatag aaattaattt tgaaagcgat atacctatct acacccaact gagaaatgaa        60
     atcctaagag gaattgcctc tggtaaactt gctgaaggag aaattttgcc atcggtaaga       120
     caactagcta gtgatattgg gataaatatg catacagtaa ataaagctta taacatacta       180
     aagcaagaag gttttctaac catagacaga agaaaagggg ctgtgattaa cactaagaat       240
     ctgagatata aaaaagaaac cttgatcaat atggaaaaag aattaaaccc aataattgct       300
     gaaggaatct gctgtgatat ctcaaagaat gattttatag aaatgatcaa taaaatctat       360
     gatgattata aggtggaaga ataa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page