(data stored in ACNUC7421 zone)

EMBL: CP002160.PE286

CP002160.PE286       Location/Qualifiers
FT   CDS_pept        379725..381548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0296"
FT                   /product="protein of unknown function DUF1680"
FT                   /note="PFAM: protein of unknown function DUF1680; KEGG:
FT                   pjd:Pjdr2_1987 protein of unknown function DUF1680"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50077"
FT                   /db_xref="GOA:D9SPM8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM8"
FT                   /inference="protein motif:PFAM:PF07944"
FT                   /protein_id="ADL50077.1"
FT                   /translation="MLKPINTKNIKLLPSIFKERYDLNRNYLINVKNQGLLQNFYLEAG
FT                   IILPGLQVLHNPDTDEIHWGWDAPTCQLRGHFLGHWLSAAASIFVSEQDHELKAKLDKI
FT                   IDELIKCQELNGGEWIGPIPEKYFQKLENSHHVWSPQYVMHKVLMGLMNSYIDTNSDKA
FT                   LAILDKLSNWYIKWTDDMLIKNPRAIYGGEEAGMLEVWITMYEITAEEKYLELAKKYSN
FT                   PRIFRDLEAGRDTLTNCHANASIPWSHGAAKLYEVTGDEKWRKITEAFWKNAVTDRGYY
FT                   CSGGQGAGEYWTPPFKLGLFLSDSNQEFCTVYNMIRTASYLYKWTGDTSFADYIELNLY
FT                   NGFLAQQNKYTGMPTYFLPLGAGSKKKWGTETRDFWCCHGTMVQAQTLYNSLIYFEDKE
FT                   RLVVSQYIPSELKWNYNNTDITIQQRVNMKYYNDLAFFDERDESQMSRWSLKFQVAAEK
FT                   NESFTLSFRVPKWVKELPSVTINNEKIDDLTVDEGYINIKREWSQDEVLIYFPCRLEIS
FT                   PLPDMPDTFAFMEGPIVLAGICDEERRLYGDADKPSEILMPQYQHTYGVFPWKQGIYKT
FT                   INQPENITFMPLYEITEERYTVYFNRDKSLL"
     atgctaaaac cgataaatac aaaaaatatt aagcttttac caagtatatt caaagaaaga        60
     tatgatttga accgtaatta tctcattaat gtaaaaaatc aagggttatt acaaaatttt       120
     tatttagaag caggtataat tttacctgga cttcaggtac tgcataatcc tgatactgat       180
     gaaattcatt ggggctggga tgcaccaact tgccaattaa ggggacactt tttaggacat       240
     tggctatctg ctgctgcatc catatttgtc agtgagcaag atcatgagtt aaaagctaag       300
     ttagataaaa taatagatga acttattaaa tgtcaggaat taaatggcgg tgaatggatt       360
     ggaccgatac ccgaaaaata ttttcaaaag ctagaaaatt ctcatcatgt atggtctcct       420
     caatatgtca tgcataaagt tcttatggga ctgatgaact cttatatcga tactaacagt       480
     gataaagcac ttgcgattct tgacaagtta agtaattggt atataaagtg gacagatgat       540
     atgttgataa aaaatccacg tgctatttat ggtggcgagg aagcaggaat gctagaagta       600
     tggattacca tgtatgaaat aacagcggag gaaaagtatc tagagcttgc taaaaagtat       660
     agtaatccaa gaatttttag agatttggaa gctggtaggg ataccttaac taactgtcat       720
     gcaaatgcca gtattccatg gtcccatggg gcagctaagc tttatgaggt tactggtgat       780
     gagaaatgga gaaaaatcac agaagcattt tggaagaatg cagtgacaga tcgtggttat       840
     tactgtagtg gtggacaagg tgctggcgaa tattggacgc ctccttttaa acttggtctc       900
     tttttaagcg attcaaatca ggaattttgt acggtttata atatgataag aactgcatcc       960
     tatctatata aatggactgg agatacttct tttgctgact acatcgaact caatttgtat      1020
     aacggtttcc tcgctcagca aaataagtac acaggaatgc ctacttactt ccttccacta      1080
     ggagctggaa gtaagaaaaa gtggggaacg gaaactcgcg atttttggtg ttgtcatggt      1140
     acaatggttc aggctcagac tctatataat tcattgattt attttgaaga caaagaaagg      1200
     cttgttgtga gccaatacat tccttccgaa ttaaagtgga actataataa tacagatatt      1260
     actattcagc agagagtaaa tatgaaatat tataatgacc ttgctttttt tgatgaaaga      1320
     gatgaaagtc agatgtcacg ttggtcactg aaattccaag tcgctgctga gaaaaacgaa      1380
     agttttactc tttcgtttag agtacctaaa tgggtaaagg aactaccaag cgtaacaatc      1440
     aataatgaaa aaatcgatga tttaaccgta gatgagggat acatcaatat aaaaagagag      1500
     tggtcacaag atgaagtatt aatttacttt ccttgtaggc tagaaatttc tccattgccg      1560
     gatatgccag acacctttgc atttatggaa ggtccgattg tattggcggg tatttgtgat      1620
     gaagaaagga gattgtacgg tgatgccgat aaaccgagcg aaattttgat gccacaatac      1680
     caacacacat atggagtatt cccttggaaa cagggcatct ataagacaat caatcaacct      1740
     gaaaatataa cttttatgcc actgtatgaa ataacagaag aaagatacac agtatatttt      1800
     aatagggata aaagtttatt ataa                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page