(data stored in ACNUC7421 zone)

EMBL: CP002160.PE290

CP002160.PE290       Location/Qualifiers
FT   CDS_pept        384110..386026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0300"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cdf:CD1540 ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50081"
FT                   /db_xref="GOA:D9SPN2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN2"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADL50081.1"
FT                   /translation="MNFRELSLKMAKVNIRRYAIYFLCSGFITMLVFLYLTMYTNKDFN
FT                   DSSKVNSMISSNLFAPTLALGIFSVVFIVHFHNYFIKSRKKDFSLFMTLGLTNNDIRKI
FT                   IVLENILITAGSILVGLAMGTLFSKIFYCIVLKITDLNIDFSMNLKSYLYTIVFLGSIN
FT                   LIMILKSCVFVPVYQIIELLKAEHRADYNFMDKKIFRILGISLIISSIIIQWVGIINKK
FT                   SFIPIYVNMVISLIGIYLFVANLHFFIDKFLKLFKQKTANNLVWVSNLKYSIGSSKNII
FT                   FLSTLFLTTIVYFMSFSSTGTEILQKNIFISNPYDLAYGEVYNKNKLSEDKLKSILQDN
FT                   NVKIDSIDNLEFITQGAMTIISDERLKESLGIDLTVEKGQYTYLHQINKNDGYLHNNQE
FT                   VKSYKINEITYTCQDKIDKILFNNIPILKNTNYLIFSDEDYLKIKSTSPLKNIGNIKFI
FT                   NFNDWSKTEKVVQALIKELQDYNKKNTKQFFQNEKDDIKVFKPVSKIEDLTLLKESSRF
FT                   LMFILCFVFSLFFMASNLMIHFKLLLEEQREKVKYQKLYKIGFTERDLSSNISKELMVL
FT                   FLVPCFLGIYLGGYYICFKLSSIGFNNSYGIKYSMFTGCIYILLELLFYLAYRRYYIKK
FT                   ILS"
     atgaacttta gagaactttc attaaagatg gctaaagtta acataagaag atatgctata        60
     tactttctat gtagtggatt cataactatg ctggtttttc tgtatttaac tatgtataca       120
     aataaagatt ttaatgattc gtcaaaagta aatagtatga tatcaagtaa cttatttgct       180
     ccaactttgg ctttgggtat attttcagtt gtttttatag ttcactttca taattatttt       240
     attaaatcta gaaaaaagga tttctcactt tttatgactt tgggtttgac taataatgat       300
     ataaggaaaa ttatagtttt agagaatatt ttaatcacag ctggttctat attagtggga       360
     cttgctatgg ggactttgtt ttcaaaaata ttttattgta ttgtactaaa gataactgat       420
     cttaatatag atttctctat gaatcttaag agttatctat atacaatagt atttttaggc       480
     agtattaatt taataatgat tttaaaaagc tgtgtattcg taccagtata ccaaattata       540
     gaacttttaa aagctgagca tagagctgat tataatttta tggataaaaa aatcttcaga       600
     attctaggaa tctctcttat tattagctca attattattc agtgggttgg aataattaat       660
     aaaaaaagct ttattcctat ttatgtaaat atggttatta gtttaatagg tatatattta       720
     tttgtggcaa acttacattt ttttatagac aagtttctta agttatttaa acagaaaact       780
     gctaataatt tagtatgggt aagcaattta aaatattcca taggaagctc taagaatatt       840
     atttttttat ctacattgtt tcttactaca atagtctact ttatgagctt tagttctacc       900
     ggtacagaga tattacagaa aaatattttt ataagcaatc catatgattt agcttatgga       960
     gaagtataca ataaaaataa actctcagaa gataaattaa agagtatact tcaggataat      1020
     aatgttaaga tagattcaat agataatcta gaatttatta cccaaggagc gatgactata      1080
     atctctgatg aaaggttaaa ggaatccctt ggaattgatt taactgtaga aaaaggacaa      1140
     tacacatatt tgcaccaaat taataagaat gatggttatc tccataataa tcaagaagtc      1200
     aaaagttata aaataaatga aattacatat acttgccaag ataaaattga taaaatactt      1260
     tttaataata tacctatctt aaagaatact aactatttaa tctttagtga tgaggattac      1320
     ttaaaaataa aatcaacatc accattaaag aacataggga acattaagtt tataaatttt      1380
     aatgattgga gtaaaacgga gaaagtagta caagctttaa taaaggaact acaagattat      1440
     aataagaaaa ataccaaaca gttttttcaa aatgaaaagg atgatataaa agtctttaag      1500
     cctgtttcta agatagagga tttaacgtta ttaaaagaat ctagtaggtt cttaatgttt      1560
     atactatgct tcgtgttttc attattcttt atggcatcaa acttaatgat acatttcaag      1620
     ttattattag aagaacagcg agaaaaggtc aaatatcaaa agttgtacaa gattggattt      1680
     acagaaagag acttgtcatc aaatatttca aaagaattga tggtgttatt tttagtccct      1740
     tgttttctag gaatatattt agggggctat tatatatgtt ttaagttatc ttcaattggg      1800
     tttaataata gctatggcat aaaatattca atgttcacgg gatgtattta tattttatta      1860
     gagctgttat tctatttggc ttatagaagg tattatatta aaaaaatttt atcatag         1917
//

If you have problems or comments...

PBIL Back to PBIL home page