(data stored in ACNUC7421 zone)

EMBL: CP002160.PE291

CP002160.PE291       Location/Qualifiers
FT   CDS_pept        complement(386811..389618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0302"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cby:CLM_0764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50082"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN3"
FT                   /inference="similar to AA sequence:KEGG:CLM_0764"
FT                   /protein_id="ADL50082.1"
FT                   /translation="MLRKIETSLAILIFPLRSLSLYKKDLFLDIALSSNKNNPSNKTVV
FT                   DHLWDNLNLDFKPHNIDEVKLTLQKHYPFIFEHKEFDKSYVMCKYFDTINKLSTSLISH
FT                   RDGKITFKYWNNKNDKEIFGPYDTSQKIIILNSLSRMMPLDIVAINYLLENDMDDIDQL
FT                   DGFYSSIMLADMQLEDTLVSGVAENHLHAGACFNFAISWNIIMNIFFRGDVSYISHMGI
FT                   PSSLVEYVLSAIILRLTLCIFLFGKYSSSCECNKRFEDWISEFNHKTCFPQEDSDGVNN
FT                   ESLKESYFNNSSDEKLIYDFITLLSYGEDISKWIKNKSIISSDETDFSTYKNLWDILIK
FT                   RYSIDMEENSEDFVFDIFHRAQCVKTYGENVFIFYALKYIKEEKSDTMFSQLFLNYLRI
FT                   RTNFFNHIVQNGATVKGLDYFKKYYHKASKSIAYTDTKYYYKTLFRTMFQDNFLKKLEL
FT                   RTSINTKSFRKDLINILSAYKEVIDEDFLHKTNEILDKEYSKIGENAFPLFGLVIHLLK
FT                   EEDIRSEEKCWHLHNKDTQSTAGELYFGILQEKYMSQIQTLVNLRNEIPHLSQFILGLD
FT                   AASGENDTPISVFAPVFDKARGSNGQTLKSKNKDGKLIKNKSLAFTFHAGEDFRHLLSG
FT                   LRRIDEVIEFCKFHAGDRIGHGIALGVDAEYWKRANPVVILPRGEYLDNLLWVWGIYAN
FT                   EKDYDPKINIYLENQIYTYASEVYENMNGITTPMLFKAYENRFRKFEVNERYKTDNYLD
FT                   KPEIFCIRAADADTKIWNADKLNHVYHCKCYLKKLYEPIQVAVTDIDCGMIVKIQEIIR
FT                   KKVATKGIVVEVNPTSNAVIGEMDSLFDHHAYIINSILEDKNTKIMLNVNSDDPTVFNT
FT                   NVSNELAYLYYGLLHKNVCKEVALAWIDKLRDYGIKTSFINHQIRHKEYYQCLVEVLKN
FT                   LGADI"
     atgctaagaa aaatagaaac ctcacttgca atacttatat ttccccttag gagcttaagc        60
     ctatataaaa aagatttgtt tttagacata gccttatcat caaacaaaaa taacccaagc       120
     aacaaaacag ttgtagacca tttgtgggac aacctaaatt tagactttaa gccacacaac       180
     atcgatgaag ttaaactaac actacaaaag cattatcctt ttatctttga acataaggaa       240
     ttcgataaaa gctatgttat gtgcaaatac ttcgatacga taaacaaact ttccacctct       300
     ttgatttctc atagagatgg aaagataact tttaaatatt ggaataataa aaatgataaa       360
     gaaatctttg gaccatatga tacctctcag aaaattataa ttttaaatag tttatctaga       420
     atgatgcctt tagacatagt tgctataaat tatttattag agaatgatat ggatgatatt       480
     gatcaattgg atggatttta ctcaagcatc atgcttgcag atatgcaact tgaagatact       540
     ttagttagtg gtgttgcaga aaatcatctt catgctgggg cttgttttaa cttcgcaatt       600
     tcttggaata ttataatgaa tatatttttc cgtggagatg tatcatatat aagtcatatg       660
     gggataccgt caagccttgt agagtatgta ctttcagcta taattcttag actcacactt       720
     tgtatttttc tttttggaaa atatagtagt agctgcgaat gtaacaagcg ctttgaggat       780
     tggatttctg aatttaatca taaaacctgt ttcccccaag aagattctga cggagttaat       840
     aatgaatcac tgaaagaatc ttattttaat aattcttctg atgaaaaact catttatgac       900
     tttatcactt tactttccta cggtgaggat atttctaaat ggattaagaa taagagcatt       960
     attagcagtg atgaaacaga ctttagcact tataaaaatc tctgggatat cctaattaaa      1020
     agatattcta ttgatatgga agaaaacagc gaagattttg tctttgatat ttttcacaga      1080
     gcacaatgcg taaaaactta tggcgagaat gtgtttatat tctatgctct aaaatatatt      1140
     aaagaagaaa aaagtgatac gatgttttct cagctatttt tgaactattt aagaataagg      1200
     actaatttct ttaatcatat agttcaaaat ggtgctacag taaaaggttt ggattatttt      1260
     aaaaaatact atcataaggc aagtaaatca atcgcttata ccgatactaa gtattactat      1320
     aagacacttt ttaggactat gtttcaagat aattttctaa aaaaacttga acttcgtact      1380
     tcaataaaca ctaaatcttt tagaaaagac cttataaata ttctttcagc atataaagaa      1440
     gttattgatg aggattttct tcataagact aatgaaattc tcgataaaga atatagtaaa      1500
     ataggtgaaa atgcttttcc tctatttggt ttggtgatac atcttttaaa agaggaagat      1560
     atacgatctg aagagaaatg ttggcattta cataataaag atacccagag cactgctggt      1620
     gaattatact ttggtatctt acaagaaaag tatatgtctc aaattcaaac tttagtaaac      1680
     ttaagaaatg aaattccaca tttatctcaa tttattttag gcttagatgc tgccagcgga      1740
     gaaaatgata ctcctatttc cgtatttgct cctgtctttg ataaagctag aggtagcaat      1800
     ggacaaacgt tgaaatctaa aaataaagat ggtaagttga taaaaaataa aagcctcgct      1860
     tttactttcc atgcggggga agactttagg cacctattat ctggacttag aaggattgat      1920
     gaagttatag aattttgcaa atttcatgct ggtgatagga ttggtcacgg aatagccctt      1980
     ggtgttgacg ctgaatattg gaaacgagca aatcctgttg tgattttgcc tagaggtgaa      2040
     tatttagaca acctcctatg ggtttggggt atatatgcaa acgaaaaaga ttacgatcct      2100
     aaaataaata tctaccttga aaatcaaatt tatacttacg cttctgaagt gtatgaaaat      2160
     atgaacggca tcactactcc aatgctattt aaagcttatg agaatcgctt taggaaattt      2220
     gaagtaaatg agaggtacaa aactgataac tatttagata aaccagaaat tttttgtata      2280
     agagcagccg atgctgatac aaaaatatgg aatgcagata aattgaatca tgtatatcac      2340
     tgcaaatgct acctaaaaaa actctatgaa cctattcaag tagctgttac agatatagat      2400
     tgtggcatga ttgtgaagat acaagaaata atcagaaaaa aagtagctac taaaggcata      2460
     gtagtggaag taaacccaac ttctaacgca gtaattggag aaatggattc tttatttgac      2520
     caccatgcct atataattaa tagcatatta gaagataaaa atactaaaat aatgctaaat      2580
     gtcaactctg atgatccaac ggtgtttaat accaatgtta gtaatgaact agcttattta      2640
     tattacggat tattacataa aaatgtttgt aaagaagttg cattagcttg gatagataaa      2700
     ctacgtgact acggcataaa aacttctttc ataaatcatc aaataagaca taaagaatat      2760
     tatcaatgct tagtagaagt tttgaaaaac ttaggtgctg atatttaa                   2808
//

If you have problems or comments...

PBIL Back to PBIL home page