(data stored in ACNUC7421 zone)

EMBL: CP002160.PE292

CP002160.PE292       Location/Qualifiers
FT   CDS_pept        complement(389634..392543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0303"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cby:CLM_0763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN4"
FT                   /inference="similar to AA sequence:KEGG:CLM_0763"
FT                   /protein_id="ADL50083.1"
FT                   /translation="MREDDDKSIFIGARPLSKEEVKSIVPTYDALCDRIEDIRREAKNV
FT                   DKKYITTNKKYNNTLALFGNRGTGKTSTMYTLIEKLKKDKENIILDILEPDNIGPEGKI
FT                   IGCILGLFKQELDNLKREIEENPCILPFEIKNQFFSDCRFKESNPLQKIYNDLIEAYCY
FT                   TEKDYRTLLTNSYTDMNSYVKKTSYIFNADMEFSKKFAQFINEFVKVKKSLINGCLNEK
FT                   NEKEPLIFIFIDDVDLNTSKCHEIIEAILKYAAHPNIVCFVSGDYDTFTEAFTVSLLKK
FT                   ENLSVANINLTEHIIEKRPILQSKQVLAYEYMKKVFPNAYRHYVNYWDLALKPTYKFSN
FT                   KNKIEEKQKTLYGLLKSLLEISSKLYNPNSDVCKIENIFGFEKESDEENPEYFYPAYNM
FT                   FDITSRGLVNVYLILDRLHRTDYVKISSYNNEEPTSLFFVDVKNLIDVIIDSSNLLSPH
FT                   KNDILQNYILWSSTEEQSKIDFYQLNLLIQPMADNSSMLYNKRTKYSLFYLCYFITLLL
FT                   PNIQHIKEERKNSLKFSLYILINDQDLSEVYPYNPNISQVCPAVLYIPNISYKHFIFAL
FT                   LSENNLGVSQNIYKFFFDSEFLLSTFSNINIYNNEFGLNSSYIKFYEFLKVRKKKKNIN
FT                   LNSIKDFILSKTYETDDTTYVSIIFYSIFDNFISNSFGNSYNTLHTGIYNFFRIMKLAF
FT                   KNACTENSKPILISSENLTFYLGELLKNYKDNLHINSPSDLSTTSNLLYNIHNKHLENE
FT                   NTYLNIDTTIQSSIYSSFSRHFINQILTRYNNYSNLMIDISSSTEKLQTLFAVDTSDST
FT                   IKIHIENLKTKLFSRFNSFTEMGTSSHEDNEMPIKIINLDLYFNVVDDLKKLLYAHKIQ
FT                   SIDIKDILNNLITSLENDFKIEFTSSPLKEEKFFTDDEKWAIRAYSLFIQQSRPEILDL
FT                   TKLQEAKIYIKQLIESNREKQNKSENAIYERLKIDSDEE"
     atgagagaag atgacgataa gagtattttt ataggtgcaa gaccgcttag taaggaagaa        60
     gtcaaatcta tcgttcctac ctatgatgca ctctgcgaca gaatagaaga catacgaaga       120
     gaagcaaaaa acgttgacaa aaaatatata actacaaata agaaatataa taataccctt       180
     gccttatttg gaaatagagg tactggaaaa acctctacta tgtatactct tatagaaaaa       240
     ttaaaaaaag ataaagagaa tattatccta gatatccttg aacctgataa tattggacca       300
     gaaggtaaaa taattggctg tattcttgga ttatttaagc aagaacttga taacttaaaa       360
     agagagattg aagaaaatcc atgtatctta ccttttgaaa taaaaaatca attttttagc       420
     gactgtcgtt ttaaagaaag taatcctctt caaaaaatat ataatgacct aatagaagct       480
     tactgttata cagaaaaaga ttataggaca ttactaacaa attcatatac agatatgaat       540
     tcttatgtaa aaaagacttc ttatatattt aatgctgata tggagttctc taagaaattt       600
     gctcagttta taaatgaatt tgtaaaagta aaaaaatcac taattaatgg atgtttaaat       660
     gaaaaaaatg aaaaagaacc tctaatattt atttttatag atgatgtgga tttaaataca       720
     tctaaatgcc atgaaattat tgaagctata ttaaaatatg ctgctcatcc aaatatagtt       780
     tgctttgttt ctggggatta cgacacattc acagaggctt ttactgtttc tttacttaag       840
     aaagaaaatt tatcagtagc taatataaac cttactgaac atataataga aaaaagacct       900
     attcttcaaa gtaagcaagt tctggcttat gaatatatga aaaaggtttt tcctaatgct       960
     tacagacatt atgtgaatta ttgggactta gcacttaagc ctacttataa atttagtaat      1020
     aaaaataaga tagaagaaaa acaaaaaact ctatatggat tattaaaatc attactcgaa      1080
     attagtagta aactatataa tcctaattca gatgtttgta aaattgagaa tatttttggg      1140
     tttgaaaaag aaagtgatga agaaaatcct gaatactttt atccagcata taatatgttt      1200
     gatattactt cgagaggtct tgtgaatgta taccttatcc tagataggct acatagaact      1260
     gactatgtta aaatttcatc atataataat gaagaaccaa caagtttatt ctttgtagat      1320
     gtcaaaaact taattgatgt aattatagat tcttctaatt tgttatcacc tcataaaaat      1380
     gatattcttc agaattatat tttgtggagt tcaactgaag aacaaagtaa aattgacttt      1440
     tatcaactaa atctattaat tcagccaatg gctgataact cttcaatgtt atataataaa      1500
     cgaacaaaat attcgctttt ttatctttgc tattttataa ctttactttt acctaatatt      1560
     caacatataa aagaagaaag aaaaaattca ttgaaatttt ctttgtatat acttattaat      1620
     gatcaagacc taagtgaagt atatccttat aatccaaata tttcacaagt atgtccagct      1680
     gttctatata ttccaaatat ttcatataag catttcatat ttgctttact gagtgaaaat      1740
     aacttgggtg taagtcaaaa tatatataag tttttctttg attcagaatt tcttctttct      1800
     acatttagca atataaacat ttataataat gagtttgggc ttaattcttc atatataaaa      1860
     ttttatgaat ttttaaaagt tagaaagaaa aaaaagaata ttaatctaaa ttctatcaag      1920
     gatttcattc tgtccaaaac atatgaaaca gatgatacta catatgtaag cataatattt      1980
     tattctattt ttgataattt cataagcaac tcatttggta attcctacaa cacacttcac      2040
     acaggaattt ataatttctt tagaattatg aaattagctt tcaaaaatgc atgtactgaa      2100
     aatagtaaac ctattttaat ttcttcagaa aatttaactt tctatttagg agaattgctg      2160
     aaaaactaca aagataattt gcatattaat tcaccttcag atttatctac aacttcaaat      2220
     ttattgtaca atattcataa taaacactta gaaaatgaaa atacttactt aaacatagac      2280
     actactatcc aaagctcaat ttatagcagc ttttctcgtc actttatcaa ccaaatttta      2340
     acaagatata ataactatag caacttaatg attgacataa gttcttcaac agaaaagtta      2400
     caaaccttgt ttgctgtgga tactagtgat tccactatta aaattcatat agaaaaccta      2460
     aaaacaaaat tattttctag gttcaattca tttactgaaa tgggaacctc atcacatgag      2520
     gataatgaaa tgcctattaa aattataaac ttagatttat actttaatgt tgttgatgat      2580
     ttaaaaaaac tactttatgc gcataaaatt caaagtattg atataaaaga tatactaaat      2640
     aacttgataa cttccttaga aaatgatttt aaaatagaat ttacatcatc acccttgaaa      2700
     gaagagaaat tctttactga tgatgaaaaa tgggctatta gagcctatag cttatttatc      2760
     caacaatcca ggccagaaat acttgactta actaaacttc aagaagctaa aatatatata      2820
     aaacaactaa tagaatccaa tagagaaaaa caaaataaat ctgaaaatgc aatctacgaa      2880
     agattaaaaa tcgattctga tgaagaataa                                       2910
//

If you have problems or comments...

PBIL Back to PBIL home page