(data stored in ACNUC7421 zone)

EMBL: CP002160.PE293

CP002160.PE293       Location/Qualifiers
FT   CDS_pept        393002..393748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0304"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: ABC transporter related protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50084"
FT                   /db_xref="GOA:D9SPN5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50084.1"
FT                   /translation="MLETETEVITISKVEVKLGDNVILKDIDLNIRKGEIVGFLGPSGS
FT                   GKTTLVKAIIGMNKASGGNIEVLGVRMPSLEIATKIGYMAQSDALYEDLNAMGNLIFFA
FT                   ELYGVKRKEAKIRAEEVLALVGLSEYAKKAVRYFSGGMKRRLSLAIALMHKPQILILDE
FT                   PTVGIDPVLRKSFWNEFEKIRAAGGTIIVTTHVMDEAYKCDRLALIREGEIIAEGSPEE
FT                   IIKATGARNIEEAFLCYSGVKEEAEA"
     atgttagaga ctgaaacaga ggttattacc atatcaaagg ttgaagttaa gcttggagat        60
     aatgttattt taaaggatat agatctaaat atcagaaaag gcgaaatagt tggcttcttg       120
     ggaccatctg gttcaggaaa gacaaccttg gttaaagcta taattggtat gaataaagca       180
     agtggtggga atatagaagt acttggagta aggatgccat ctctagaaat agctacaaaa       240
     atagggtata tggcacaaag cgatgcttta tatgaagatc ttaatgccat gggaaatctt       300
     attttctttg cagaattata tggtgttaaa agaaaagaag caaagattag agcagaagag       360
     gttttagctt tagtaggtct ttcagagtat gctaaaaagg cagtaagata tttttctggt       420
     ggaatgaaaa gaaggttatc tctagctata gccttgatgc acaaaccaca aattttaatt       480
     ctagatgagc ctacagtagg aattgatcca gtccttagaa aaagtttctg gaatgagttt       540
     gagaaaataa gagctgctgg aggaactata attgtcacta ctcatgtaat ggatgaagct       600
     tataaatgtg atagattggc gttaataaga gaaggggaaa tcatagctga aggaagtcca       660
     gaagaaatta tcaaggcaac tggtgctagg aatatagaag aagccttctt atgctacagt       720
     ggggtaaagg aggaagcaga ggcgtga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page