(data stored in ACNUC7421 zone)

EMBL: CP002160.PE304

CP002160.PE304       Location/Qualifiers
FT   CDS_pept        complement(406778..407011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0315"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC2598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50095"
FT                   /db_xref="InterPro:IPR024997"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP6"
FT                   /inference="similar to AA sequence:KEGG:CAC2598"
FT                   /protein_id="ADL50095.1"
FT                   /translation="MSDKSKIIKVKKNTQGDIIYVMLENGNVYPINEIITMAKEHLIEG
FT                   VNVAKSRNGREYLRSNPNDEEDDNLDNKPTFQ"
     atgagtgata agtctaagat tataaaagta aaaaagaata cccaaggaga cataatatac        60
     gtaatgcttg aaaacggaaa tgtatatcca ataaatgaga taataaccat ggcaaaagaa       120
     catttaattg aaggagtcaa tgttgcaaaa tcaagaaatg gtagagaata cttaagaagc       180
     aacccaaatg atgaggaaga cgacaatcta gataataagc caacttttca ataa             234
//

If you have problems or comments...

PBIL Back to PBIL home page