(data stored in ACNUC7421 zone)

EMBL: CP002160.PE306

CP002160.PE306       Location/Qualifiers
FT   CDS_pept        409029..410057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0317"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="KEGG: atu:Atu3137 C4-dicarboxylate-binding protein;
FT                   TIGRFAM: TRAP dicarboxylate transporter, DctP subunit;
FT                   PFAM: Extracellular solute-binding protein, family 7"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50097"
FT                   /db_xref="GOA:D9SPP8"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP8"
FT                   /inference="protein motif:TFAM:TIGR00787"
FT                   /protein_id="ADL50097.1"
FT                   /translation="MLKKVISISMLMIGILSFSGCSNKTEGNTYIDMIENKNTSVKTLF
FT                   LAESQAPEYPTTKGDYEFARLVKEKTDGRINIQVVTNSELGSEKDTIAQTRMGAIDFTR
FT                   VSATPLSNYSKIMTVLSLPYLYRDEDHLWAVLSSDIGQRAFNDIEKVGLVGLTYYDSGA
FT                   RSFYNNKKEIKSVADLSGLRIRVQESDLMKSLVTSLGATPTAMDPAAVIQALAVGQIDG
FT                   AENNVATYVSSSQYNVAKYYTFDEHSRVPDILVASKTVLEGLSKEDQEIIKQAAIESSD
FT                   FQRKEWKANEDTMYKKMEDAGVKITKLDQAAKEEFKTAVKPVYDKFGADFTDLIKQIEA
FT                   TK"
     atgttaaaaa aagtaatatc gatatcgatg ctgatgattg gtatattaag tttttcggga        60
     tgtagtaata agaccgaagg caacacatat atagatatga ttgaaaataa aaatacaagt       120
     gtaaaaactt tatttctagc tgaatctcaa gcacctgaat accctacaac taagggtgat       180
     tatgaatttg ctagactagt aaaagaaaaa acagatggaa gaataaatat acaggttgtt       240
     actaattctg aactagggtc agaaaaagat actatagcac agacgcgaat gggtgctatt       300
     gattttacaa gagtaagtgc tacgccgcta tctaattact caaaaattat gactgtgtta       360
     tctttaccat atctatatag agatgaagac catttgtggg ctgtattatc tagtgatatc       420
     ggacagcggg cttttaacga tattgaaaag gtaggattag ttggattgac ttactatgat       480
     tctggagcaa gaagctttta taataataaa aaagaaatta aatcagtggc agatttaagt       540
     ggattaagaa taagggttca agaaagtgac cttatgaaat cactagttac gtcattagga       600
     gctaccccta cagcgatgga tccagcggct gttattcaag ctctagcagt aggacaaatt       660
     gatggtgcag aaaataacgt agctacctat gtttcctctt ctcaatataa tgttgccaag       720
     tattatacct ttgatgagca ttcaagagta ccagatatat tagtagcaag taaaacggta       780
     ttagaaggac tttcaaaaga agatcaggaa ataataaagc aagcagcaat agaatcgtca       840
     gattttcaaa gaaaagaatg gaaagctaat gaagacacta tgtataagaa gatggaagat       900
     gcaggagtca aaataactaa acttgaccaa gcagcaaagg aagagtttaa aacggctgta       960
     aaacctgttt atgataagtt tggagcagac ttcacagatt taatcaaaca aattgaagcg      1020
     acaaaatag                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page