(data stored in ACNUC7421 zone)

EMBL: CP002160.PE308

CP002160.PE308       Location/Qualifiers
FT   CDS_pept        411262..411558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0319"
FT                   /product="protein of unknown function DUF1292"
FT                   /note="PFAM: protein of unknown function DUF1292; KEGG:
FT                   sth:STH1993 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50099"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ0"
FT                   /inference="protein motif:PFAM:PF06949"
FT                   /protein_id="ADL50099.1"
FT                   /translation="MEENQIEYELIEKIEIRNRSYAIIAEKGKEDEAFVMRIKEVKGVK
FT                   DLVPVNDDKEFDEVMKKYEEKFIDVDDAGDEEKLIEEDEETITEIDDLAGNER"
     atggaagaaa atcagataga atatgaatta atagaaaaaa tagaaataag aaatagaagc        60
     tatgctataa tagcagaaaa aggcaaagaa gatgaagctt ttgtaatgag aattaaagaa       120
     gtaaaaggag tcaaagattt agtgcctgta aatgatgata aagaatttga tgaagttatg       180
     aaaaaatatg aagaaaaatt tatagatgtt gatgatgctg gtgatgagga aaagttaata       240
     gaagaagatg aagaaacaat aacagagata gatgatttag ccggtaatga aagataa          297
//

If you have problems or comments...

PBIL Back to PBIL home page