(data stored in ACNUC7421 zone)

EMBL: CP002160.PE31

CP002160.PE31        Location/Qualifiers
FT   CDS_pept        63430..64080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0033"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   Ser/Thr and Tyr protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49822"
FT                   /db_xref="GOA:D9SMN7"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN7"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADL49822.1"
FT                   /translation="MEKFKAALKHSWIFFVYAAVGLIYEVVNRPWGEVRNISTALDANI
FT                   PFIKEFIIPYMSWHLFTVGCGIYLLFKDRRNYYKSMYSVIIGLIICYATYIVFQTTVPR
FT                   PTVVGDDILSQFVRKMYSHDKPMNCFPSIHVYTTVLFTYFILITNRLKKYQIAMMVTWA
FT                   VSIVLSTLFVKQHVILDVVGACALVYACVGLVNWFEARNDVKINNTVENEGQV"
     atggagaaat ttaaggctgc acttaagcat agttggatat tttttgttta tgcagcagta        60
     ggattaattt acgaggttgt gaatagacct tggggagagg taagaaatat ttctaccgca       120
     ttagatgcga atataccctt tattaaggaa tttattattc cgtatatgtc ttggcattta       180
     ttcacggtag gctgtggaat atatcttcta tttaaagata gacgaaatta ttacaagtcc       240
     atgtatagcg taataattgg tttaataatt tgttatgcaa cttatattgt ttttcaaact       300
     acggttccga gacctacagt tgtgggagac gatatcttat cacaatttgt aagaaagatg       360
     tacagtcatg ataagccaat gaactgtttt cctagtatac atgtgtatac aaccgtgctt       420
     tttacttatt ttattttaat aacaaataga ttaaaaaaat atcaaatagc tatgatggta       480
     acatgggcag tctctatagt actatcaact ctttttgtaa agcaacatgt aatcttagat       540
     gtagttggag catgtgctct agtttatgct tgcgtaggac tagttaattg gtttgaggca       600
     aggaatgatg ttaagataaa caatactgtt gagaatgaag gtcaagttta a                651
//

If you have problems or comments...

PBIL Back to PBIL home page