(data stored in ACNUC7421 zone)

EMBL: CP002160.PE311

CP002160.PE311       Location/Qualifiers
FT   CDS_pept        413795..414562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0322"
FT                   /product="hydrolase, TatD family"
FT                   /note="KEGG: cno:NT01CX_0686 TatD family hydrolase;
FT                   TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50102"
FT                   /db_xref="GOA:D9SPQ3"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ3"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ADL50102.1"
FT                   /translation="MIFDTHAHYDDDAFDEDREEIIREITENGVKNILNCAASMDGVYK
FT                   SIELAKKYDCFYAAVGIHPEHADQLDKDNLEIIRNLAKESKVLAIGEIGLDYYWEENPP
FT                   REVQQKALRDQMKLAEELDLPVIIHDREAHEDTLKILKEFPRVKGVVHAYSGSVEMARQ
FT                   CVKLGYYLGIGGVLTFKNARKLVEVVEEIPLEHLVVETDAPYMTPVPYRGERNRSDYIS
FT                   YVIKKIAEIKNIEEETVNKRLISNSYDLLKIGK"
     atgatttttg acactcatgc tcattatgat gatgacgctt ttgacgaaga tagagaagaa        60
     attatcagag agataacaga aaatggagtt aaaaacatat tgaattgcgc agcttccatg       120
     gatggggttt ataaatctat agaacttgcg aaaaaatatg attgttttta tgcagcagtg       180
     ggaattcatc cagaacatgc agatcaattg gataaagata atttagagat tataagaaat       240
     ttggcaaaag agtcaaaggt tttagctata ggagaaatcg ggctagatta ttattgggag       300
     gagaatcctc caagagaagt gcagcaaaaa gcacttagag atcaaatgaa gctagcagaa       360
     gaattagact tacctgtaat tattcacgat agagaagctc atgaggatac tctaaaaatc       420
     ctaaaggagt ttccaagggt taaaggtgtt gttcatgcat actctggaag tgtggaaatg       480
     gcgaggcaat gcgttaaact aggttattat cttggcatcg gaggagtatt aaccttcaag       540
     aatgctagaa aactcgttga ggtagtagag gaaatacccc tagaacattt ggtggtagag       600
     actgatgcgc cttatatgac gcctgttcca tatagaggag aaaggaatag atctgattac       660
     ataagctatg tcattaagaa aatagcagag attaaaaaca tagaggaaga aactgtaaat       720
     aaacgactga tttctaattc ttatgatttg ctaaaaattg gtaaatga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page