(data stored in ACNUC7421 zone)

EMBL: CP002160.PE312

CP002160.PE312       Location/Qualifiers
FT   CDS_pept        414798..415874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0323"
FT                   /product="G5 domain protein"
FT                   /note="PFAM: G5 domain protein; 3D domain-containing
FT                   protein; protein of unknown function DUF348; KEGG:
FT                   cbl:CLK_3254 3D/G5 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50103"
FT                   /db_xref="GOA:D9SPQ4"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ4"
FT                   /inference="protein motif:PFAM:PF07501"
FT                   /protein_id="ADL50103.1"
FT                   /translation="MLTNIKTTFEKATRNFSNGTKAVIFFLLLILIISPIIIIGQVRKN
FT                   VTFMVDENPIEVVTYKSNLKDILTEANIELAPEDIISTGLDSKIKDGQIVDIKKAVNIT
FT                   INVDGKQVKIKSAQDDIDTLLKSEECLDTFKNANISSIRSNDRIIPDIKEPLEEGSIVN
FT                   ITRMDTRVETKSQQLDYQVVTENDPNVYVGERRVVQDGQVGHKDVEELVSLEDGVEVSR
FT                   KVVAEKITLQPVNQVISEGSKPKQVQVVSSRGETIPYAFSRVLTMRATAYSKQQEGLTD
FT                   RTATGEYVVHDESGYSTIAVDPRVIPLGTKLYISGYGLAIASDTGGAIVDDRIDVYFDT
FT                   IAECTSWGIRSVEVYVLE"
     atgctgacca atattaaaac tacctttgaa aaagctacta gaaatttttc aaacggtact        60
     aaagcagtaa tctttttctt gctcctgata ctaattatca gtccaattat cattattgga       120
     caagtgagaa agaatgtcac ctttatggtg gacgaaaacc cgatagaggt tgtaacctac       180
     aaaagcaacc taaaagatat cttaaccgaa gctaatatag aattggcacc agaggatatt       240
     atttcaacag gtttagactc aaaaataaag gatggacaaa tcgtagatat taaaaaagca       300
     gtaaatatta caatcaacgt agatggaaaa caggttaaga taaaatcagc acaagacgac       360
     atagatactt tactgaaaag tgaagaatgt ctagacacct ttaagaatgc gaacataagc       420
     tcaattcgaa gtaatgacag aataatacca gacattaaag agcctttaga agaaggttca       480
     atagttaaca taactagaat ggatacaagg gtagaaacta aaagtcagca attagattac       540
     caagtcgtaa cagaaaatga tccaaatgtt tatgttggag aacgaagagt tgttcaagat       600
     gggcaagttg gacataaaga cgttgaagaa ctggtatctt tggaagacgg ggttgaagtg       660
     tctagaaaag ttgtagcaga aaaaattact ttgcaacctg taaatcaggt aataagcgag       720
     ggaagtaaac caaaacaagt tcaagtagtt tcttctcgtg gtgaaacaat accatatgca       780
     tttagcagag ttttaacaat gcgagcaaca gcttattcaa agcaacaaga aggtttgaca       840
     gacaggactg caacgggaga gtatgtcgta catgatgaaa gtggatacag tactatagcc       900
     gttgatccac gagtaattcc gcttggcacc aaattataca tctcaggata cggacttgca       960
     attgcttcag atactggtgg agcaatagta gatgacagaa tagatgtgta ttttgatacc      1020
     atagcagaat gtacaagttg gggtattaga tccgttgagg tctatgtact ggaataa         1077
//

If you have problems or comments...

PBIL Back to PBIL home page