(data stored in ACNUC7421 zone)

EMBL: CP002160.PE313

CP002160.PE313       Location/Qualifiers
FT   CDS_pept        416129..417274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0324"
FT                   /product="3D domain-containing protein"
FT                   /note="PFAM: 3D domain-containing protein; KEGG:
FT                   cbh:CLC_2685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50104"
FT                   /db_xref="GOA:D9SPQ5"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ5"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADL50104.1"
FT                   /translation="MSKSVKAIAALCVTAMLFSTNVQAVQSSEDVQNQINSQQAELNDL
FT                   KKEKDQLLGQIDQYADEIADTMATIDANNKKMDQIQTDIDKAIADIETAEKDEKEAREK
FT                   YYERLRLMYKNNNNMIIEILFSSSSLGDLLEKVKVIQKIGQSTEGILEQLKDKQANTKQ
FT                   RQDELVLENEKLEDTKKQNETYLSEVQAKMDKANGLSKQLQEKEGQKAKEIESSKATLD
FT                   DIKKKEAEAKLQDFENSESPQGGNTVSEGGAGVLTPGPSPTIEQPNLVESGVTSRGTND
FT                   VSYSRKYTMISTAYTAGNPGVGSRTASGLPVSRNPGGYSTVAVDPSVIPLGTKLYISGY
FT                   GYAIAADTGSAIKSKKIDVYFNTLKECYSWGVRYVEVYVLE"
     atgagtaaat cagtgaaagc aattgcagca ttgtgtgtaa cagctatgtt atttagtacg        60
     aatgtacaag cagtgcaaag ctctgaagat gtacaaaatc aaattaattc acagcaagct       120
     gaattaaatg accttaaaaa agaaaaagat cagttattag gacaaataga tcagtacgct       180
     gatgaaatag ctgataccat ggctaccata gacgcaaata ataaaaaaat ggaccaaatc       240
     caaactgata tagataaagc tattgctgat atagaaacag cagagaaaga cgaaaaagaa       300
     gctagagaaa agtattatga aagattaaga cttatgtaca agaataacaa taatatgata       360
     atagagatat tattttcttc atctagctta ggagatttac ttgaaaaggt caaggtcatc       420
     caaaaaatag gacaaagcac cgaaggcatt ttagaacaat taaaggataa gcaagctaat       480
     acaaagcaaa ggcaagatga actagtttta gaaaatgaaa aacttgaaga tactaaaaag       540
     caaaatgaga cgtacctaag tgaggtacaa gctaaaatgg ataaagcaaa tggtttatca       600
     aagcaacttc aagaaaagga aggccaaaaa gctaaagaga tagaatcatc aaaagcaact       660
     cttgatgaca ttaagaaaaa ggaagcagaa gcaaaattac aggattttga aaactcggaa       720
     tcgcctcaag gtggcaatac tgttagtgaa ggaggtgctg gtgttttaac acctgggcca       780
     agtcctacaa tagaacagcc aaatcttgta gaaagtggag tcacttcaag aggaacaaat       840
     gatgtttcat attcaaggaa gtatacgatg atatcgacag cttatactgc tggtaatcct       900
     ggtgtaggaa gtagaacagc ttctggattg cccgttagta gaaatccagg tggatatagc       960
     actgtagcag tagatccgtc agtaattcca ctaggaacca aactttatat atccggctat      1020
     ggatatgcta tagcggctga tactggttca gcgataaaaa gtaaaaagat agatgtatat      1080
     tttaatactc taaaagaatg ttatagttgg ggtgttagat acgtagaagt atatgtatta      1140
     gaatag                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page