(data stored in ACNUC7421 zone)

EMBL: CP002160.PE314

CP002160.PE314       Location/Qualifiers
FT   CDS_pept        417635..418189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0325"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="TIGRFAM: primase/topoisomerase like protein; PFAM:
FT                   TOPRIM domain-containing protein; KEGG: cpr:CPR_2527
FT                   primase-like protein; SMART: Toprim sub domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50105"
FT                   /db_xref="GOA:D9SPQ6"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ6"
FT                   /inference="protein motif:TFAM:TIGR00334"
FT                   /protein_id="ADL50105.1"
FT                   /translation="MIKEIIVVEGRDDVTAVKRAVDAEVISVSGFGINAKVIEKIKEAQ
FT                   KRQGVIVLTDPDFAGEKIRKIISKRIPEVKHAYISRIEGTKDGDIGVENAEPAAIIKAL
FT                   ENAKCEMKEKREEFDIEDLIFFKLTADPDAKVRREALGKELRIGYGNANQLLKRLNNFG
FT                   VTKEEFMVAMNKINEETKNGK"
     atgataaaag aaataatagt ggtagaagga agagatgatg taactgctgt taaaagagcc        60
     gtggatgcag aagttatatc tgtaagcggc tttggaataa atgcaaaggt tattgaaaag       120
     ataaaggaag cacagaaaag acaaggagta atagtcttaa cagatcctga ttttgctgga       180
     gaaaaaataa gaaagataat ttcaaaaaga atcccagagg ttaagcatgc gtatatctca       240
     agaattgaag gaactaagga tggagatatt ggtgttgaga atgcagaacc tgctgctata       300
     attaaagctc ttgaaaatgc aaaatgtgag atgaaagaaa aaagagaaga atttgatata       360
     gaggatttga tattctttaa actcactgct gatccagatg ctaaagtaag gagagaagca       420
     ttagggaagg aacttaggat tggctatgga aatgcaaatc aacttttaaa aaggttaaat       480
     aattttgggg ttactaagga agaatttatg gtagccatga ataaaattaa tgaggagacg       540
     aaaaatggca aataa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page