(data stored in ACNUC7421 zone)

EMBL: CP002160.PE321

CP002160.PE321       Location/Qualifiers
FT   CDS_pept        complement(423676..424176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0332"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="KEGG: cac:CAC0898 shikimate kinase; PFAM: shikimate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50112"
FT                   /db_xref="GOA:D9SPR3"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR3"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ADL50112.1"
FT                   /translation="MKNLILIGMPGCGKSTIGKLAAMKLGIPFVDVDEYIENKYDAKVS
FT                   EIFEKKGEKFFRDLESTCIKELSEKTDLVISTGGGSVLREENMINLKANGVIMFIDRSP
FT                   EDIISDVDIASRPLLAQGSERIYTLYNERINLYTKYCDHHITNNSSIDTVVNTLLLQYI
FT                   VKK"
     atgaaaaatt taattcttat tggaatgcct ggctgtggta aaagtaccat tggcaagcta        60
     gcagccatga aacttggcat accatttgta gatgtagatg agtatattga aaataaatat       120
     gatgcaaaag tatccgaaat atttgaaaaa aaaggcgaga aattttttag agatttagaa       180
     tctacttgta taaaagaatt atctgaaaaa actgatttag ttatttccac tggtggtggt       240
     tctgttttaa gagaagagaa tatgattaac ttaaaagcta acggagttat catgtttatt       300
     gatagatctc cagaagacat aatttctgat gtagatatcg catcaagacc acttcttgca       360
     caaggtagtg aaagaatcta cactctttat aacgagagaa taaacttata tactaagtac       420
     tgtgaccacc acattacaaa taacagttcc attgatactg tagtaaatac tcttttactg       480
     caatacatcg taaaaaagta a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page