(data stored in ACNUC7421 zone)

EMBL: CP002160.PE327

CP002160.PE327       Location/Qualifiers
FT   CDS_pept        complement(430065..430196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0338"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdl:CDR20291_1726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50118"
FT                   /db_xref="GOA:D9SPR9"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR9"
FT                   /inference="similar to AA sequence:KEGG:CDR20291_1726"
FT                   /protein_id="ADL50118.1"
FT                   /translation="MKAIIKTIVSTVEYYYFSLGFYFSAGYFYCRKFNIAFNESVAS"
     atgaaagcaa tcataaaaac tatagtttct acagttgaat attattattt tagcttgggc        60
     ttttatttta gcgcaggtta tttttactgt agaaaattta atatagcttt taatgagtcg       120
     gttgcttcgt ag                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page