(data stored in ACNUC7421 zone)

EMBL: CP002160.PE330

CP002160.PE330       Location/Qualifiers
FT   CDS_pept        complement(430996..431838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0341"
FT                   /product="degV family protein"
FT                   /note="KEGG: ckr:CKR_2066 hypothetical protein; TIGRFAM:
FT                   degV family protein; PFAM: DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50121"
FT                   /db_xref="GOA:D9SPS2"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPS2"
FT                   /inference="protein motif:TFAM:TIGR00762"
FT                   /protein_id="ADL50121.1"
FT                   /translation="MEKIAIITDSTCDLPKAEIDKYNIKVARLKVKYSDREYTDGIDIT
FT                   PEEIYARLDKEIPTTSTPTLGEIDNLFKEVIAENYTHAIVIPISSGLSGTMNNFRLVAD
FT                   GYDEIETFVFDSRALSRAVGFLLTKVGDMIAEGKSFKEITSEIPKLRENMELYFTVDSL
FT                   EHLIKGGRIGRISGSLGQLLNLKPIVSMDEEGKYYTVDKVRGSKQAFNKLVNFGLEQLN
FT                   NHKCRIMVMHANVPESAQKLYDAFKDHPNLTSIELGTLSAVAGVHSGPTLFAFVYMRE"
     ttggaaaaaa tagcgataat cacagatagt acatgtgact tacctaaagc tgagatagat        60
     aaatacaata taaaggttgc aagattaaag gttaaatatt cagaccgtga atatactgat       120
     ggaatagaca ttactcctga agaaatttat gcaagacttg ataaggaaat tcctaccacc       180
     tcaactccaa ctctaggaga aatagataac ttatttaaag aagtaatagc tgaaaattac       240
     actcatgcta ttgttattcc aatatcttct ggtttatctg gaacaatgaa taactttaga       300
     ttagttgcag atggctacga tgagatagag acttttgttt ttgactcaag agcattatca       360
     cgtgctgtag gatttttatt aacaaaagtt ggtgatatga tagcagaggg aaaaagtttt       420
     aaagaaatca cttctgaaat tcctaagctt agagaaaaca tggagctata ttttacagtt       480
     gattccttgg aacacttaat taaaggtggt agaatcggta gaatatcagg ttctttagga       540
     caactgctta acttaaaacc tatagtttct atggatgaag agggaaaata ctatacagta       600
     gataaagtta gaggctcaaa acaagccttt aataaactgg ttaattttgg attagaacaa       660
     ttaaataatc ataaatgtag aatcatggtt atgcatgcaa atgtcccaga atcagcacaa       720
     aaattatatg atgccttcaa agatcatcct aacttaactt caatcgaact tggaaccctt       780
     agtgctgtag ctggtgtcca ttcaggccct acactatttg catttgttta tatgagagaa       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page