(data stored in ACNUC7421 zone)

EMBL: CP002160.PE331

CP002160.PE331       Location/Qualifiers
FT   CDS_pept        432364..434811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0342"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; KEGG: ckl:CKL_0995 glucose-1-phosphate
FT                   nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50122"
FT                   /db_xref="GOA:D9SQ55"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ55"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADL50122.1"
FT                   /translation="MKAIVMAGGEGTRLRPLTCNIPKPMMPILGKPVMEYAIENLRKIG
FT                   ITQIGVTLQYLPDEVINYFGDGKEFGVNIQYFIEETPLGTAGSVKNAESFLDETFVVIS
FT                   GDALTDIHLEKAIKYHKEKEAMATMILKEVSVPLEYGVVVTDKDGKVNGFLEKPSWSEL
FT                   FSDKANTGIYILEPEIFSFYEQNQKFDFSNDLFPIMLKENKPLMGYVADGYWCDIGSIE
FT                   QYMKCSYDILSGLVDVDINAVEVEDGVWVGKDCTISPKATITPPVYIGNKCRIYEGSKI
FT                   GPFSIIGKNNIISSNCNIKRSIMFDNCYIGTRVELKGTVLCNKVQMESRAAAFEESSIG
FT                   DETLVCSKATIKPGVKIWPEKVVESGSIIKSNLIWGGKHTKSIFGKQGVVGEVNVDITP
FT                   EFVAKLGSAYGSNLSHGAKVAISCNDYGASQMFKYALATGLLSMGIEIFDLKRVTTSMA
FT                   RHTAHLFGADGAIHVMQDREDAQKVTIQFMDENGVNISSSMERKIEGTLLREDFRRVKA
FT                   DELRRIDHYEDCIEYYIRHIINSLDDKLVMEKKYNLVISVREKYVAKAVFKICETLKIG
FT                   IKEYDTPKDIKGLAREVVNSGANMGIYFSDDGEEAVIIDEKGTIIRNSIYEALKAYILL
FT                   KRSNLKVYATPVSSSMALEKIAEMCESKLVRTKTSQKDVFNGFLSGISEGGVSKEEILR
FT                   WYLMSLDSICMFALTLNHLAKYNTTVSALISLIPRYNSKKAETLCPWNKKGKVMRSLIE
FT                   QHEIASIDLIEGIKLNYKNTWALVLPDKEEPLCRIYAESESKEKVDEIIADLTRKIENI
FT                   VYN"
     atgaaggcta tagtaatggc cggtggagaa ggcacaagac ttagaccact tacctgtaat        60
     atcccaaagc caatgatgcc tattttggga aaacctgtta tggagtatgc catagaaaac       120
     ttaagaaaaa taggtattac tcaaatagga gtaacacttc agtatttacc tgatgaagta       180
     ataaactatt ttggtgacgg aaaagagttt ggagtaaata tacaatattt tattgaggaa       240
     acccctttag gaacagcagg aagtgttaaa aacgcagaga gctttttaga tgagacgttt       300
     gttgttataa gtggtgacgc cctaacggat atacatctgg aaaaggctat taaatatcat       360
     aaagaaaaag aagcgatggc gactatgatt ttaaaagagg tctcagtgcc attagaatat       420
     ggggtagttg taactgataa agacggaaaa gtaaacggtt ttcttgaaaa accaagttgg       480
     agcgaacttt tcagtgacaa ggctaatacc ggaatatata tactagagcc agaaatattt       540
     agcttctatg aacaaaatca aaagtttgat ttttctaatg atttgtttcc gattatgtta       600
     aaggaaaata agccactcat gggttatgtg gcagatggtt attggtgtga tatcggaagt       660
     atagaacaat atatgaaatg tagttatgat atactcagtg gtctggtaga cgtagatata       720
     aatgcagttg aggtagaaga tggtgtatgg gtagggaaag attgtactat tagtccaaag       780
     gcaacaatca ctcctccggt atacataggg aataagtgta ggatatacga aggaagtaaa       840
     ataggaccat ttagcattat aggtaaaaat aatattatat cttccaactg caacataaag       900
     agaagtataa tgtttgacaa ctgttatata ggcacaaggg ttgaacttaa aggaactgtg       960
     ctttgtaata aggttcagat ggagtctaga gctgctgctt ttgaagaaag ctctattggt      1020
     gatgaaactt tagtatgttc aaaggcaacg ataaaaccag gagtaaaaat ctggcctgaa      1080
     aaggtcgtag agagtggaag tataattaag agtaatctta tatggggtgg aaaacatacg      1140
     aaatccattt ttggcaaaca aggagttgta ggagaggtaa atgttgatat aactcctgag      1200
     tttgtagcta agcttggatc agcgtatgga tcaaatttaa gtcacggtgc taaagtggct      1260
     ataagttgta atgattatgg agcttcacag atgtttaagt atgcattagc aacaggattg      1320
     ctttcaatgg gaatagagat ttttgactta aagagggtta ctacttccat ggcaagacat      1380
     acggcacatc tatttggtgc tgatggtgct attcatgtga tgcaagatag agaagatgct      1440
     cagaaagtaa ccattcagtt tatggacgag aatggagtaa atataagttc tagtatggaa      1500
     agaaaaatag aaggaaccct tttaagggaa gattttagaa gagttaaagc agatgaactt      1560
     agaagaatag atcattatga agattgtatt gaatattata tacgacatat aatcaatagt      1620
     ttagatgata agcttgttat ggaaaagaag tacaacttag taataagtgt acgtgaaaaa      1680
     tacgtggcta aggctgtttt caagatatgt gaaacattga agataggaat taaggaatat      1740
     gatactccaa aggatataaa aggtcttgca agagaagttg taaatagtgg agctaatatg      1800
     ggaatttatt tttctgatga tggagaagag gctgtaatta tcgatgagaa aggaacaata      1860
     ataagaaatt ccatatacga agcactgaag gcatatatat tgctaaaaag aagtaacttg      1920
     aaagtctatg cgacacctgt tagtagttct atggctcttg aaaagatagc agagatgtgt      1980
     gagtcaaagc ttgtaagaac taagacttct cagaaggatg tgtttaatgg atttttatca      2040
     ggtatttcag agggaggagt aagtaaagaa gagattcttc gttggtattt gatgagttta      2100
     gattccatat gtatgtttgc attaacttta aatcatttag caaaatacaa tacaactgtt      2160
     agtgctttaa tcagtttgat acctaggtat aactctaaaa aggcggaaac cttatgtcct      2220
     tggaataaaa aaggtaaggt catgaggagt ctcatagagc agcatgaaat agctagtatt      2280
     gacttaattg aaggtataaa gctaaattat aagaatactt gggccttagt acttccggat      2340
     aaggaagaac ccctttgtag gatatatgca gaatctgaaa gtaaagagaa ggtcgatgaa      2400
     ataatagcag atcttacaag aaagatagaa aatatagtgt ataattaa                   2448
//

If you have problems or comments...

PBIL Back to PBIL home page