(data stored in ACNUC7421 zone)

EMBL: CP002160.PE332

CP002160.PE332       Location/Qualifiers
FT   CDS_pept        435215..437326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0343"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; KEGG: cbe:Cbei_0068 anaerobic ribonucleoside
FT                   triphosphate reductase; PFAM: ATP-cone domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50123"
FT                   /db_xref="GOA:D9SQ56"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ56"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ADL50123.1"
FT                   /translation="MLYVVKRDGRKVKFNSDKITKAIKRSSEELGYDLKESEAIDLTQG
FT                   IITSIEEEDLEEVTVEQIQNFVEKVLTEKGYTNISKSYSAYRNERTRVRELKSDLMKAI
FT                   QLIGVETDRDNANVGNNFSSKLLRIASESNKWHNLSSMPKQLAKAHENGDVYYHDLDSY
FT                   NLTVNCLHIPTKEVLTRGFNTGYGYIRVPKRIESAAELSCILLQSTQNDMFGGQSHPDF
FT                   DNDMSCFVATTREQIRIELSELGITEEKINQVIEKKVKNAVAQAMQGVVYNLNTMHSRA
FT                   GSQVPFSSINLGIPQSEDAALVCQVFLEEYDKGLGNGEQPIFPNIIFRVKNGVNREPQD
FT                   PYYYLFKLACKVAAKRMNPTFMNIDSDFNKEYYDKGYLPATMGCRTYLMSNINGEPGTK
FT                   GRGNIAPTTINLPRIAILAKKDVDKFFELLENRLLLARESLLHRYQVLRNLKIKDLPFV
FT                   AGQGLMKGAEGLGPDDSIEPILRQGSWGIGFIGLAETLVALIGKHHGETEEAGELGFKI
FT                   INYIREFADKYKEVDKLNWSCYATPAEGLSGKFILKDQQVFGKIKGVTDKEYYTNSYHV
FT                   PVGFPVSITDKIKIEAPYHKLCNGGHISYLELDDYPDGETIEDIITYAYKNTNISYLGI
FT                   NFHIKYCRHCGTYLNYGQHKCPNCGSNDIQGISRVTGYLSLDERFGAGKVAERRDRLSH
FT                   GTSVRTYVE"
     gtgctatatg tagttaaacg agatggaaga aaagttaaat tcaacagtga taaaatcaca        60
     aaagctatta aaagatcatc tgaggaacta ggttatgatc ttaaagaaag cgaggcaata       120
     gacttaactc aaggaataat tacttctatt gaggaagaag acttagaaga agttactgtt       180
     gaacaaatac agaactttgt ggagaaggtt ttaacagaaa aaggctatac gaatattagt       240
     aaatcttatt cagcctacag aaacgaaaga acaagagtaa gagaacttaa gtcagacctt       300
     atgaaggcaa tacagcttat aggagtggaa actgacagag ataatgcaaa cgtaggtaat       360
     aattttagtt caaagctttt aagaatagct agtgaatcga ataagtggca taacttatca       420
     tcaatgccaa aacagttagc caaagctcat gaaaatggag atgtatatta tcacgattta       480
     gatagttata atctaacagt taattgtctt cacattccaa caaaagaagt attaacaaga       540
     ggatttaata caggttacgg atacataagg gttccaaaga gaatcgagtc agctgcagag       600
     ttatcttgta tacttcttca atcaacacag aatgatatgt ttggtggtca atctcatcca       660
     gattttgaca acgacatgtc ttgttttgtt gcgactacca gagaacaaat aagaatagaa       720
     cttagtgaat taggtataac tgaagaaaaa ataaatcaag ttatagagaa aaaagttaaa       780
     aacgctgtgg cacaggcaat gcaaggggtt gtttataatc ttaatacaat gcattctagg       840
     gcaggaagtc aagtgccatt tagttcaata aatttaggaa ttcctcaaag tgaagatgca       900
     gcattggttt gccaagtttt ccttgaagag tatgataaag gtcttggtaa tggagaacag       960
     ccaatattcc cgaacataat ttttagagtt aaaaatggtg ttaatagaga gccacaagat      1020
     ccatattatt atttgtttaa gcttgcatgc aaagtggcag ctaagagaat gaacccaacc      1080
     tttatgaata tagattcaga ctttaacaaa gaatactatg ataaaggtta tcttccagct      1140
     actatgggat gtaggacata tttaatgagc aatataaatg gtgagcctgg aactaaggga      1200
     agaggtaaca tagcgccaac aactattaac ttaccaagga tagcaatact tgcaaagaag      1260
     gatgtagata aattctttga acttctagaa aatagactac ttcttgcaag agaaagctta      1320
     cttcatagat atcaagtcct tagaaactta aagattaagg atttaccatt cgtagcaggt      1380
     caaggattaa tgaagggcgc tgaaggctta ggacctgatg atagtataga acctattcta      1440
     agacaaggtt cttggggtat tggttttata ggccttgcag aaactttagt tgcgctaatt      1500
     ggaaaacacc atggagaaac agaagaagca ggagaactag gctttaagat tataaactac      1560
     attagagaat ttgcagataa gtacaaagaa gtagataaac ttaattggtc atgttatgct      1620
     acaccagccg aaggtctttc aggtaaattt atattaaaag atcagcaagt gtttggaaaa      1680
     ataaaaggtg ttacagataa agaatattat acaaatagtt atcatgtacc agtaggattt      1740
     ccagtatcta taacagataa aattaagata gaagcaccgt atcataaact ttgcaatggt      1800
     ggacatataa gttatttaga attagatgat tatccagatg gagaaactat agaagatata      1860
     ataacttatg catataaaaa tacaaacata agttatttag gaataaattt ccacataaaa      1920
     tattgtagac attgcggtac ctatttaaat tatggacaac ataaatgtcc aaattgtggt      1980
     agcaatgata tacaaggaat atcaagggtt actggatatt taagtcttga tgaaagattt      2040
     ggagcaggaa aagttgcaga acgaagagat aggctctctc atggaacaag tgtaagaacc      2100
     tatgtagagt aa                                                          2112
//

If you have problems or comments...

PBIL Back to PBIL home page