(data stored in ACNUC7421 zone)

EMBL: CP002160.PE333

CP002160.PE333       Location/Qualifiers
FT   CDS_pept        437343..437840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0344"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="KEGG: cbf:CLI_0150 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein;
FT                   TIGRFAM: anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50124"
FT                   /db_xref="GOA:D9SQ57"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ57"
FT                   /inference="protein motif:TFAM:TIGR02491"
FT                   /protein_id="ADL50124.1"
FT                   /translation="MNKLKVGGFLDNSLVNGIGLRSVIFVSGCTHECQGCHNQELQCFS
FT                   YGEEVTIEEIMDRIKKNLGIIRGVTLSGGDPMEQPQNLMQLSKEIKKLNLNIWCYTGYT
FT                   YEEILNDQDKSELLKEIDVLVDGPFILKLKDEGLKYKGSSNQRIIDVKKSIEQDKVVLL
FT                   DI"
     atgaacaaac taaaagttgg aggatttcta gataattcct tggttaatgg aataggatta        60
     agatctgtaa tctttgtatc tggttgcact cacgaatgtc aaggatgtca taatcaagaa       120
     cttcaatgtt tttcttacgg agaagaggtt actattgaag aaataatgga cagaattaag       180
     aaaaatcttg gtattattag aggggttact cttagtggtg gagatccaat ggaacaacct       240
     caaaatctga tgcaattaag caaagagata aaaaaactta acctaaatat ctggtgttat       300
     accggatata cctacgaaga aatcttaaat gatcaggata aatctgaatt attaaaagag       360
     atagatgtat tggtggatgg accatttatt ttaaaactaa aggatgaggg attaaaatac       420
     aagggttcta gcaatcaaag aattattgat gtaaagaaat ctattgaaca agataaagta       480
     gtattactag atatataa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page